It looks like this is a web page, not a feed. I looked for a feed associated with this page, but couldn't find one. Please enter the address of your feed to validate.

Source: http://dgm-online.ru

  1. <!DOCTYPE html><html lang="ru"><meta name="geo" content="Москва"/><head><meta charSet="utf-8"/><meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=5"/><title>DGM в Москве — специализированный маркетплейс</title><meta name="description" content="Вся продукция DGM на специализированном маркетплейсе по низким ценам! Характеристики, фото, максимальный ассортимент. Оперативная доставка в Москве!"/><meta property="og:title" content="DGM в Москве — специализированный маркетплейс"/><meta property="og:description" content="Вся продукция DGM на специализированном маркетплейсе по низким ценам! Характеристики, фото, максимальный ассортимент. Оперативная доставка в Москве!"/><meta property="og:image" content=""/><meta property="og:type" content="website"/><meta name="google-site-verification" content="QOvgzq9JnSWoUXeRKs_almH7ktFKn1lxYn61ffisBg0"/><meta name="next-head-count" content="9"/><link rel="preload" as="font" type="font/woff2" href="/fonts/roboto-v30-latin_cyrillic-regular.woff2"/><link rel="preload" as="font" type="font/woff" href="/fonts/roboto-v30-latin_cyrillic-regular.woff"/><link rel="preload" as="font" type="font/woff2" href="/fonts/roboto-v30-latin_cyrillic-500.woff2"/><link rel="preload" as="font" type="font/woff" href="/fonts/roboto-v30-latin_cyrillic-500.woff"/><link rel="preload" as="font" type="font/woff2" href="/fonts/roboto-v30-latin_cyrillic-700.woff2"/><link rel="preload" as="font" type="font/woff" href="/fonts/roboto-v30-latin_cyrillic-700.woff"/><link rel="preload" href="/_next/static/css/8108189c9abe490e.css" as="style"/><link rel="stylesheet" href="/_next/static/css/8108189c9abe490e.css" data-n-g=""/><link rel="preload" href="/_next/static/css/aa89b0d0420b65df.css" as="style"/><link rel="stylesheet" href="/_next/static/css/aa89b0d0420b65df.css" data-n-p=""/><noscript data-n-css=""></noscript><script defer="" nomodule="" src="/_next/static/chunks/polyfills-c67a75d1b6f99dc8.js"></script><script src="/_next/static/chunks/webpack-9da843227d103ed2.js" defer=""></script><script src="/_next/static/chunks/framework-b78bc773b89d3272.js" defer=""></script><script src="/_next/static/chunks/main-4d012d2bb61cdaf1.js" defer=""></script><script src="/_next/static/chunks/pages/_app-ca06c5bcdaea2d6e.js" defer=""></script><script src="/_next/static/chunks/3547-d9249be565346328.js" defer=""></script><script src="/_next/static/chunks/1838-cced3911546a5a50.js" defer=""></script><script src="/_next/static/chunks/pages/index-87f5b68b57ccb231.js" defer=""></script><script src="/_next/static/1Y7T-XcOMWjqKLrwqOiZl/_buildManifest.js" defer=""></script><script src="/_next/static/1Y7T-XcOMWjqKLrwqOiZl/_ssgManifest.js" defer=""></script><style data-styled="" data-styled-version="5.3.11">.bTABjq{width:100%;max-width:1500px;margin:0 auto;padding-left:30px;padding-right:30px;}/*!sc*/
  2. @media (max-width:600px){.bTABjq{padding-right:20px;padding-left:20px;}}/*!sc*/
  3. data-styled.g3[id="wrapper-style__Wrapper-sc-53eabab1-1"]{content:"bTABjq,"}/*!sc*/
  4. .hcGrsc{-webkit-flex:1;-ms-flex:1;flex:1;}/*!sc*/
  5. @media (max-width:992px){.hcGrsc{margin-top:135px;}}/*!sc*/
  6. .hcGrsc.fixedContainer{margin-top:92px;}/*!sc*/
  7. @media (max-width:1000px){.hcGrsc.fixedContainer{margin-top:93px;}}/*!sc*/
  8. @media (max-width:480px){.hcGrsc.fixedContainer{margin-top:124.78px;}}/*!sc*/
  9. data-styled.g4[id="wrapper-style__PageContainer-sc-53eabab1-2"]{content:"hcGrsc,"}/*!sc*/
  10. .jryakX{padding:12px 20px;width:100%;background:#E54E8D;border-radius:3px;font-weight:500;font-size:12px;-webkit-letter-spacing:0.03em;-moz-letter-spacing:0.03em;-ms-letter-spacing:0.03em;letter-spacing:0.03em;text-transform:uppercase;color:#ffffff;white-space:nowrap;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-transition:0.25s;transition:0.25s;}/*!sc*/
  11. .jryakX .loader__Loader-sc-1c971be7-0{color:white;margin-left:10px;width:18px;height:18px;}/*!sc*/
  12. .jryakX:hover{background:#F25292;}/*!sc*/
  13. .jryakX:disabled{background:#E64E8D;}/*!sc*/
  14. .jryakX.outline{background:transparent;border:1px solid #E54E8D;box-sizing:border-box;color:#E54E8D;padding:10px 20px;}/*!sc*/
  15. .jryakX.outline:hover{background:#E54E8D;color:white;}/*!sc*/
  16. .jryakX.secondary{background:#fafafa;color:#686A70;}/*!sc*/
  17. .jryakX.secondary:hover{background:#f9f7fa;color:#302E30;}/*!sc*/
  18. .jryakX:disabled{opacity:0.5;}/*!sc*/
  19. data-styled.g7[id="button-style__StyledButton-sc-adb9ac65-0"]{content:"jryakX,"}/*!sc*/
  20. @media (max-width:768px){.cOwaEK path.broken{display:none;}}/*!sc*/
  21. data-styled.g10[id="icon-heart__StyledIconHeart-sc-6dcbbacc-0"]{content:"cOwaEK,"}/*!sc*/
  22. .cXIMUt{position:relative;}/*!sc*/
  23. data-styled.g14[id="location-button-style__LocationButtonContainer-sc-68155fee-0"]{content:"cXIMUt,"}/*!sc*/
  24. .gCoGvW{padding:6.5px 14px;background:#3a373b;border-radius:3px;height:42px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;}/*!sc*/
  25. .gCoGvW:hover{background:#444045;}/*!sc*/
  26. data-styled.g15[id="location-button-style__LocationButton-sc-68155fee-1"]{content:"gCoGvW,"}/*!sc*/
  27. .hTgthp{color:#E54E8D;}/*!sc*/
  28. data-styled.g16[id="location-button-style__LocationButtonIcon-sc-68155fee-2"]{content:"hTgthp,"}/*!sc*/
  29. .doQUOZ{font-size:14px;color:#f6f5f7;margin-left:6px;}/*!sc*/
  30. data-styled.g17[id="location-button-style__LocationButtonText-sc-68155fee-3"]{content:"doQUOZ,"}/*!sc*/
  31. .eeUyMx{position:relative;display:inline-grid;}/*!sc*/
  32. .eeUyMx.left{justify-items:flex-start;}/*!sc*/
  33. .eeUyMx .popover-style__DropContent-sc-5f84575-0{z-index:2;}/*!sc*/
  34. .eeUyMx.center{justify-items:center;}/*!sc*/
  35. .eeUyMx.right{justify-items:flex-end;}/*!sc*/
  36. .eeUyMx.right .popover-style__DropContent-sc-5f84575-0.top::before{right:5px;left:unset;}/*!sc*/
  37. data-styled.g23[id="popover-style__StyledPopover-sc-5f84575-1"]{content:"eeUyMx,"}/*!sc*/
  38. .jxyjBB{position:relative;width:18px;height:12px;top:-1px;}/*!sc*/
  39. .jxyjBB div{position:absolute;width:18px;height:2px;border-radius:1px;background:white;-webkit-transition:0.25s;transition:0.25s;}/*!sc*/
  40. .jxyjBB div:nth-child(2){width:13px;top:6px;}/*!sc*/
  41. .jxyjBB div:nth-child(3){top:12px;}/*!sc*/
  42. data-styled.g24[id="catalogue-button-style__ButtonIcon-sc-4d1a01b0-0"]{content:"jxyjBB,"}/*!sc*/
  43. .jPYXNA{font-weight:500;font-size:12px;-webkit-letter-spacing:0.03em;-moz-letter-spacing:0.03em;-ms-letter-spacing:0.03em;letter-spacing:0.03em;text-transform:uppercase;color:#ffffff;margin-left:10px;}/*!sc*/
  44. data-styled.g25[id="catalogue-button-style__ButtonText-sc-4d1a01b0-1"]{content:"jPYXNA,"}/*!sc*/
  45. .ka-dLhZ{background:#e64e8d;border-radius:3px;box-sizing:border-box;width:124px;height:42px;-webkit-transition:background-color 0.25s;transition:background-color 0.25s;will-change:backround-color;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;border:1px solid transparent;border-radius:3px;}/*!sc*/
  46. .ka-dLhZ:hover{background:#f25292;}/*!sc*/
  47. .ka-dLhZ:hover .catalogue-button-style__ButtonIcon-sc-4d1a01b0-0 div:nth-child(2){width:18px;}/*!sc*/
  48. .ka-dLhZ:hover .catalogue-button-style__ButtonIcon-sc-4d1a01b0-0 div:nth-child(3){width:14px;}/*!sc*/
  49. .ka-dLhZ.active{background-color:transparent;border-color:#e64e8d;}/*!sc*/
  50. .ka-dLhZ.active .catalogue-button-style__ButtonText-sc-4d1a01b0-1{color:#E54E8D;}/*!sc*/
  51. .ka-dLhZ.active .catalogue-button-style__ButtonIcon-sc-4d1a01b0-0 div{background:#e64e8d;border-radius:0;}/*!sc*/
  52. .ka-dLhZ.active .catalogue-button-style__ButtonIcon-sc-4d1a01b0-0 div:nth-child(1){top:6px;-webkit-transform:rotate(45deg);-ms-transform:rotate(45deg);transform:rotate(45deg);}/*!sc*/
  53. .ka-dLhZ.active .catalogue-button-style__ButtonIcon-sc-4d1a01b0-0 div:nth-child(2){top:6px;-webkit-transform:rotate(-45deg);-ms-transform:rotate(-45deg);transform:rotate(-45deg);width:18px;margin-top:0;}/*!sc*/
  54. .ka-dLhZ.active .catalogue-button-style__ButtonIcon-sc-4d1a01b0-0 div:nth-child(3){opacity:0;-webkit-transform:rotate(-45deg);-ms-transform:rotate(-45deg);transform:rotate(-45deg);}/*!sc*/
  55. @media (max-width:1000px){.ka-dLhZ{width:58px;}.ka-dLhZ .catalogue-button-style__ButtonText-sc-4d1a01b0-1{display:none;}}/*!sc*/
  56. data-styled.g26[id="catalogue-button-style__StyledCatalogueButton-sc-4d1a01b0-2"]{content:"ka-dLhZ,"}/*!sc*/
  57. .eEJVmX{width:100%;border:1px solid #d9dde7;box-sizing:border-box;border-radius:3px;padding:17px 40px 17px 17px;height:54px;-webkit-transition:all ease-in-out 0.2s;transition:all ease-in-out 0.2s;font-size:15px;color:#302E30;}/*!sc*/
  58. .eEJVmX::-webkit-input-placeholder{color:#686A70;}/*!sc*/
  59. .eEJVmX::-moz-placeholder{color:#686A70;}/*!sc*/
  60. .eEJVmX:-ms-input-placeholder{color:#686A70;}/*!sc*/
  61. .eEJVmX::placeholder{color:#686A70;}/*!sc*/
  62. .eEJVmX:hover{border-color:#302E30;}/*!sc*/
  63. .eEJVmX:focus{box-shadow:none;outline:none;border-color:#825BD3;}/*!sc*/
  64. data-styled.g27[id="input-search-style__InputElement-sc-b0882a39-0"]{content:"eEJVmX,"}/*!sc*/
  65. .MarsX{position:absolute;top:0;bottom:0;right:16px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;}/*!sc*/
  66. .MarsX .input-search-style__Divider-sc-b0882a39-1,.MarsX .input-search-style__Icon-sc-b0882a39-2.close{display:none;}/*!sc*/
  67. data-styled.g30[id="input-search-style__IconContainers-sc-b0882a39-3"]{content:"MarsX,"}/*!sc*/
  68. .ebeqsY{position:relative;}/*!sc*/
  69. .ebeqsY:hover .input-search-style__Icon-sc-b0882a39-2.searchicon{color:#302E30;}/*!sc*/
  70. .ebeqsY .input-search-style__Icon-sc-b0882a39-2{color:#686A70;pointer-events:none;}/*!sc*/
  71. .ebeqsY .input-search-style__Icon-sc-b0882a39-2 svg{cursor:auto;}/*!sc*/
  72. .ebeqsY .input-search-style__Icon-sc-b0882a39-2.close{color:#686a70;}/*!sc*/
  73. @media (max-width:480px){.ebeqsY .input-search-style__InputElement-sc-b0882a39-0{padding:11px;font-size:14px;line-height:19px;}}/*!sc*/
  74. data-styled.g31[id="input-search-style__StyledInput-sc-b0882a39-4"]{content:"ebeqsY,"}/*!sc*/
  75. .cpUrDT{width:100%;position:relative;}/*!sc*/
  76. .cpUrDT .input-search__InputSearch-sc-38e72f27-0{height:42px;}/*!sc*/
  77. .cpUrDT .input-search__InputSearch-sc-38e72f27-0::-webkit-input-placeholder{color:#9ca0a9;}/*!sc*/
  78. .cpUrDT .input-search__InputSearch-sc-38e72f27-0::-moz-placeholder{color:#9ca0a9;}/*!sc*/
  79. .cpUrDT .input-search__InputSearch-sc-38e72f27-0:-ms-input-placeholder{color:#9ca0a9;}/*!sc*/
  80. .cpUrDT .input-search__InputSearch-sc-38e72f27-0::placeholder{color:#9ca0a9;}/*!sc*/
  81. @media (max-width:1000px){.cpUrDT input{font-size:14px;}}/*!sc*/
  82. data-styled.g33[id="search-style__StyledSearch-sc-d63d0256-0"]{content:"cpUrDT,"}/*!sc*/
  83. .bARgSC{margin-right:30px;}/*!sc*/
  84. data-styled.g36[id="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0"]{content:"bARgSC,"}/*!sc*/
  85. .eCQYtw{width:100px;height:100px;position:relative;margin-left:auto;-webkit-flex-shrink:0;-ms-flex-negative:0;flex-shrink:0;}/*!sc*/
  86. data-styled.g37[id="popular-category-style__PopularCategoryRight-sc-bf41b6b-1"]{content:"eCQYtw,"}/*!sc*/
  87. .jVExFt{font-size:17px;line-height:120%;color:#302E30;overflow:hidden;text-overflow:ellipsis;display:-moz-box;-moz-box-orient:vertical;display:-webkit-box;-webkit-line-clamp:2;-webkit-box-orient:vertical;line-clamp:2;max-width:140px;box-orient:vertical;}/*!sc*/
  88. @media (max-width:480px){.jVExFt{padding:0 30px;max-width:unset;}}/*!sc*/
  89. data-styled.g38[id="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2"]{content:"jVExFt,"}/*!sc*/
  90. .crnwPt{font-size:13px;line-height:140%;color:#9CA0A9;margin-top:14px;}/*!sc*/
  91. .crnwPt.offers{margin-top:5px;}/*!sc*/
  92. data-styled.g39[id="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3"]{content:"crnwPt,"}/*!sc*/
  93. .bpbeBg{width:100%;padding:30px 30px 40px 30px;box-sizing:border-box;border-radius:3px;cursor:pointer;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;box-shadow:0px 2px 25px rgba(49,18,59,0.08);}/*!sc*/
  94. .bpbeBg:hover{box-shadow:0px 2px 12px rgba(99,47,117,0.14);}/*!sc*/
  95. .bpbeBg:hover .popular-category-style__PopularCategoryTitle-sc-bf41b6b-2{color:#E54E8D;}/*!sc*/
  96. @media (max-width:1050px){.bpbeBg{width:345px;}}/*!sc*/
  97. @media (max-width:480px){.bpbeBg{padding:0;min-width:160px;width:160px;min-height:151px;border:none;height:151px !important;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column-reverse;-ms-flex-direction:column-reverse;flex-direction:column-reverse;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;text-align:center;}.bpbeBg .popular-category-style__PopularCategoryRight-sc-bf41b6b-1{margin-bottom:12px;margin-left:0;width:70px;height:70px;}.bpbeBg .popular-category-style__PopularCategoryRight-sc-bf41b6b-1 svg{width:78px;height:78px;}.bpbeBg .popular-category-style__PopularCategoryLeft-sc-bf41b6b-0{margin-right:0;}.bpbeBg .popular-category-style__PopularCategoryTitle-sc-bf41b6b-2{padding:0 30px;font-size:14px;line-height:16px;}.bpbeBg .popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3{display:none;margin-top:10px;font-size:11px;line-height:15px;}.bpbeBg .popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3.offers{margin-top:0;}}/*!sc*/
  98. @media (max-width:380px){.bpbeBg{min-width:140px;width:140px;}}/*!sc*/
  99. .bKBfLR{width:100%;padding:30px 30px 40px 30px;box-sizing:border-box;border-radius:3px;cursor:pointer;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;box-shadow:0px 2px 25px rgba(49,18,59,0.08);}/*!sc*/
  100. .bKBfLR:hover{box-shadow:0px 2px 12px rgba(99,47,117,0.14);}/*!sc*/
  101. .bKBfLR:hover .popular-category-style__PopularCategoryTitle-sc-bf41b6b-2{color:#E54E8D;}/*!sc*/
  102. @media (max-width:1050px){.bKBfLR{width:345px;}}/*!sc*/
  103. @media (max-width:480px){.bKBfLR{padding:0;min-width:160px;width:160px;min-height:151px;border:none;height:151px !important;display:none;-webkit-flex-direction:column-reverse;-ms-flex-direction:column-reverse;flex-direction:column-reverse;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;text-align:center;}.bKBfLR .popular-category-style__PopularCategoryRight-sc-bf41b6b-1{margin-bottom:12px;margin-left:0;width:78px;height:78px;}.bKBfLR .popular-category-style__PopularCategoryRight-sc-bf41b6b-1 svg{width:78px;height:78px;}.bKBfLR .popular-category-style__PopularCategoryLeft-sc-bf41b6b-0{margin-right:0;}.bKBfLR .popular-category-style__PopularCategoryTitle-sc-bf41b6b-2{padding:0 30px;font-size:14px;line-height:16px;}.bKBfLR .popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3{display:none;margin-top:10px;font-size:11px;line-height:15px;}.bKBfLR .popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3.offers{margin-top:0;}}/*!sc*/
  104. @media (max-width:380px){.bKBfLR{min-width:140px;width:140px;}}/*!sc*/
  105. data-styled.g40[id="popular-category-style__StyledPopularCategory-sc-bf41b6b-4"]{content:"bpbeBg,bKBfLR,"}/*!sc*/
  106. .fbpxga{width:40px;height:34px;position:relative;-webkit-flex-shrink:0;-ms-flex-negative:0;flex-shrink:0;}/*!sc*/
  107. data-styled.g41[id="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0"]{content:"fbpxga,"}/*!sc*/
  108. .iVjvUh{width:100%;height:34px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;padding:0px 12px;border-radius:3px;font-size:14px;line-height:140%;margin-left:7px;}/*!sc*/
  109. data-styled.g42[id="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1"]{content:"iVjvUh,"}/*!sc*/
  110. .iEBwwG{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;}/*!sc*/
  111. .iEBwwG.active .category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1{color:#E54E8D;background:#f9f7fa;}/*!sc*/
  112. .iEBwwG:hover .category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1{background:#f9f7fa;color:#E54E8D;}/*!sc*/
  113. data-styled.g43[id="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2"]{content:"iEBwwG,"}/*!sc*/
  114. .chkWLl{background:#2b292b;}/*!sc*/
  115. data-styled.g84[id="footer-style__FooterTop-sc-5e53f7f6-0"]{content:"chkWLl,"}/*!sc*/
  116. .konXTw{background:#2b292b;}/*!sc*/
  117. data-styled.g85[id="footer-style__FooterBottom-sc-5e53f7f6-1"]{content:"konXTw,"}/*!sc*/
  118. .iroqSO{padding-top:30px;padding-bottom:48px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;font-size:12px;line-height:150%;color:#686A70;}/*!sc*/
  119. @media (max-width:992px){.iroqSO{padding-bottom:100px;}}/*!sc*/
  120. @media (max-width:480px){.iroqSO{padding-bottom:40px;padding-top:15px;}}/*!sc*/
  121. data-styled.g86[id="footer-style__FooterBottomContent-sc-5e53f7f6-2"]{content:"iroqSO,"}/*!sc*/
  122. .hbAPAo{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;}/*!sc*/
  123. data-styled.g87[id="footer-style__LogoBlock-sc-5e53f7f6-3"]{content:"hbAPAo,"}/*!sc*/
  124. .fikKbJ{background:linear-gradient(219.96deg,#6f5ee2 9.42%,#e04c8a 91%);height:42px;width:42px;border-radius:50%;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;font-weight:900;font-size:14px;-webkit-letter-spacing:0.05em;-moz-letter-spacing:0.05em;-ms-letter-spacing:0.05em;letter-spacing:0.05em;text-transform:uppercase;color:#ffffff;}/*!sc*/
  125. data-styled.g88[id="footer-style__Logo-sc-5e53f7f6-4"]{content:"fikKbJ,"}/*!sc*/
  126. .iiOmsY{margin-left:9px;}/*!sc*/
  127. data-styled.g89[id="footer-style__LogoMarketNameBlock-sc-5e53f7f6-5"]{content:"iiOmsY,"}/*!sc*/
  128. .dNSWIw{font-size:13px;line-height:140%;color:#9CA0A9;margin-top:-5px;}/*!sc*/
  129. data-styled.g90[id="footer-style__LogoMarketSubname-sc-5e53f7f6-6"]{content:"dNSWIw,"}/*!sc*/
  130. .ksPSfO{background:#686a70;height:42px;width:1px;margin-left:10px;margin-right:10px;}/*!sc*/
  131. data-styled.g91[id="footer-style__LogoDivider-sc-5e53f7f6-7"]{content:"ksPSfO,"}/*!sc*/
  132. .bXexqT{font-size:13px;line-height:140%;color:#9CA0A9;max-width:135px;}/*!sc*/
  133. data-styled.g92[id="footer-style__LogoMarketDescription-sc-5e53f7f6-8"]{content:"bXexqT,"}/*!sc*/
  134. .gsGLlq{font-weight:700;font-size:24px;line-height:120%;color:white;}/*!sc*/
  135. @media (max-width:480px){.gsGLlq{line-height:20px;}}/*!sc*/
  136. data-styled.g93[id="footer-style__LogoMarketName-sc-5e53f7f6-9"]{content:"gsGLlq,"}/*!sc*/
  137. .cFhTCh{display:grid;grid-template-columns:repeat(2,auto);grid-column-gap:70px;grid-row-gap:12px;}/*!sc*/
  138. .cFhTCh a{font-size:14px;line-height:140%;color:#9CA0A9;}/*!sc*/
  139. .cFhTCh a:hover{color:white;}/*!sc*/
  140. data-styled.g94[id="footer-style__FooterNav-sc-5e53f7f6-10"]{content:"cFhTCh,"}/*!sc*/
  141. .eHHvPv{font-size:14px;line-height:140%;color:#686A70;margin-bottom:15px;}/*!sc*/
  142. data-styled.g96[id="footer-style__FooterBlockTitle-sc-5e53f7f6-12"]{content:"eHHvPv,"}/*!sc*/
  143. .kyDkYk{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;}/*!sc*/
  144. data-styled.g98[id="footer-style__FooterBlockSocialsContent-sc-5e53f7f6-14"]{content:"kyDkYk,"}/*!sc*/
  145. .fOytEd{width:34px;height:34px;border:1px solid #686a70;box-sizing:border-box;border-radius:50%;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;color:#9ca0a9;}/*!sc*/
  146. .fOytEd:hover{color:white;}/*!sc*/
  147. .fOytEd:hover.vk{background-color:#4c6c91;border-color:#4c6c91;}/*!sc*/
  148. .fOytEd:hover.facebook{background-color:#3b5998;border-color:#3b5998;}/*!sc*/
  149. .fOytEd:hover.twitter{background-color:#55acee;border-color:#55acee;}/*!sc*/
  150. .fOytEd:hover.ok{background-color:#f68634;border-color:#f68634;}/*!sc*/
  151. .fOytEd:hover.youtube{background-color:#ff0000;border-color:#ff0000;}/*!sc*/
  152. .fOytEd:hover.youtube svg path:nth-child(2){fill:#ff0000;}/*!sc*/
  153. .fOytEd:hover.instagram{background-color:#ffffff;border-color:#ffffff;color:black;}/*!sc*/
  154. data-styled.g99[id="footer-style__FooterSocial-sc-5e53f7f6-15"]{content:"fOytEd,"}/*!sc*/
  155. .itNWsU .footer-style__FooterSocial-sc-5e53f7f6-15:not(:first-child){margin-left:14px;}/*!sc*/
  156. data-styled.g100[id="footer-style__FooterSocials-sc-5e53f7f6-16"]{content:"itNWsU,"}/*!sc*/
  157. .dNCFlh{font-size:12px;line-height:150%;color:#686A70;margin-top:50px;width:100%;}/*!sc*/
  158. data-styled.g102[id="footer-style__FooterTopSEO-sc-5e53f7f6-18"]{content:"dNCFlh,"}/*!sc*/
  159. .dRIxGt{width:600px;margin-left:auto;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;-webkit-box-pack:end;-webkit-justify-content:flex-end;-ms-flex-pack:end;justify-content:flex-end;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;}/*!sc*/
  160. data-styled.g104[id="footer-style__FooterBottomRight-sc-5e53f7f6-20"]{content:"dRIxGt,"}/*!sc*/
  161. .jeGrWS a{margin-left:2px;color:#E54E8D;}/*!sc*/
  162. .jeGrWS br{display:none;}/*!sc*/
  163. data-styled.g105[id="footer-style__FooterBottomOffer-sc-5e53f7f6-21"]{content:"jeGrWS,"}/*!sc*/
  164. .gazDUR{margin-top:20px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;}/*!sc*/
  165. .gazDUR a{display:block;line-height:120%;padding:0px 1px;border-bottom:1px solid #686A70;}/*!sc*/
  166. .gazDUR a:hover{border:none;}/*!sc*/
  167. .gazDUR a:not(:first-child){margin-left:30px;}/*!sc*/
  168. data-styled.g106[id="footer-style__FooterBottomLinks-sc-5e53f7f6-22"]{content:"gazDUR,"}/*!sc*/
  169. .bQkbHv{margin-top:20px;}/*!sc*/
  170. .bQkbHv.responsive{display:none;}/*!sc*/
  171. @media (max-width:480px){.bQkbHv{display:none;}.bQkbHv.responsive{display:block;}}/*!sc*/
  172. data-styled.g107[id="footer-style__FooterBottomText-sc-5e53f7f6-23"]{content:"bQkbHv,"}/*!sc*/
  173. .ROZoi{text-align:right;}/*!sc*/
  174. @media (max-width:480px){.ROZoi{margin-top:15px;width:100%;text-align:left;}}/*!sc*/
  175. data-styled.g108[id="footer-style__FooterBottomUpdateDate-sc-5e53f7f6-24"]{content:"ROZoi,"}/*!sc*/
  176. .fheyse{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;margin-top:8px;}/*!sc*/
  177. data-styled.g109[id="footer-style__FooterBootomCopyright-sc-5e53f7f6-25"]{content:"fheyse,"}/*!sc*/
  178. .bvJIBl{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:justify;-webkit-justify-content:space-between;-ms-flex-pack:justify;justify-content:space-between;-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;gap:10px;}/*!sc*/
  179. data-styled.g112[id="footer-style__FooterTopContentFlex-sc-5e53f7f6-28"]{content:"bvJIBl,"}/*!sc*/
  180. .cKeGOT{padding-top:60px;padding-bottom:30px;border-bottom:1px solid #3d3b3d;}/*!sc*/
  181. @media (max-width:1353px){.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28{-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{margin-left:0;grid-template-columns:1fr 1fr;}.cKeGOT .footer-style__FooterLocation-sc-5e53f7f6-17{-webkit-flex-basis:20%;-ms-flex-preferred-size:20%;flex-basis:20%;}}/*!sc*/
  182. @media (max-width:1215px){.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{margin-top:38px;width:560px;-webkit-order:4;-ms-flex-order:4;order:4;grid-template-columns:repeat(3,1fr);}}/*!sc*/
  183. @media (max-width:1170px){.cKeGOT .footer-style__FooterLocation-sc-5e53f7f6-17{-webkit-flex-basis:unset;-ms-flex-preferred-size:unset;flex-basis:unset;}}/*!sc*/
  184. @media (max-width:1000px){.cKeGOT{padding-top:50px;padding-bottom:30px;border-bottom:1px solid #3d3b3d;}.cKeGOT .footer-style__LogoBlock-sc-5e53f7f6-3 .footer-style__Logo-sc-5e53f7f6-4{width:39px;height:39px;}.cKeGOT .footer-style__LogoBlock-sc-5e53f7f6-3 .footer-style__LogoMarketSubname-sc-5e53f7f6-6{font-size:12px;}.cKeGOT .footer-style__LogoBlock-sc-5e53f7f6-3 .footer-style__LogoMarketDescription-sc-5e53f7f6-8{line-height:15px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15{width:30px;height:30px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15:not(:first-child){margin-left:15px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15.instagram div svg{width:14px;height:14px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15.youtube div svg{width:14px;height:10px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15.ok div svg{height:15px;width:10px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15.twitter div svg{width:14px;height:12px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15.facebook div svg{width:8px;height:16px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15.vk div svg{width:16px;height:9px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15 div{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;}.cKeGOT .footer-style__FooterNav-sc-5e53f7f6-10{width:540px;}.cKeGOT .footer-style__FooterTopSEO-sc-5e53f7f6-18{margin-top:35px;font-size:12px;line-height:18px;}}/*!sc*/
  185. @media (max-width:836px){.cKeGOT .footer-style__FooterLocation-sc-5e53f7f6-17{width:100%;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28{-webkit-box-pack:start;-webkit-justify-content:flex-start;-ms-flex-pack:start;justify-content:flex-start;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16{margin-left:36px;}}/*!sc*/
  186. @media (max-width:780px){.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16{margin-left:37px;}}/*!sc*/
  187. @media (max-width:768px){.cKeGOT .footer-style__FooterLocation-sc-5e53f7f6-17{margin-top:10px;}}/*!sc*/
  188. @media (max-width:741px){.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__LogoBlock-sc-5e53f7f6-3{-webkit-flex-basis:100%;-ms-flex-preferred-size:100%;flex-basis:100%;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterLocation-sc-5e53f7f6-17{margin-top:0;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{margin-top:25px;margin-bottom:0;grid-column-gap:36px;grid-row-gap:8px;-webkit-order:0;-ms-flex-order:0;order:0;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterSocials-sc-5e53f7f6-16{margin-top:25px;margin-bottom:25px;margin-left:0;-webkit-flex-basis:100%;-ms-flex-preferred-size:100%;flex-basis:100%;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterSocials-sc-5e53f7f6-16 .footer-style__FooterSocial-sc-5e53f7f6-15{font-size:13px;line-height:18px;}}/*!sc*/
  189. @media (max-width:517px){.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{grid-template-columns:1fr 0.9fr 1.1fr;}}/*!sc*/
  190. @media (max-width:505px){.cKeGOT{padding-top:36px;padding-bottom:0;border-bottom:none;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{margin-top:15px !important;margin-bottom:0;width:100%;grid-column-gap:30px;}.cKeGOT .footer-style__FooterSocials-sc-5e53f7f6-16{margin-bottom:0 !important;margin-top:15px !important;}.cKeGOT .footer-style__FooterLocation-sc-5e53f7f6-17{margin-top:15px !important;}.cKeGOT .footer-style__FooterTopSEO-sc-5e53f7f6-18{margin-top:30px;}}/*!sc*/
  191. @media (max-width:472px){}/*!sc*/
  192. @media (max-width:480px){.cKeGOT{padding:0;}.cKeGOT .footer-style__FooterNav-sc-5e53f7f6-10{-webkit-box-pack:start;-webkit-justify-content:flex-start;-ms-flex-pack:start;justify-content:flex-start;}.cKeGOT .footer-style__FooterNav-sc-5e53f7f6-10 a{font-size:14px;}.cKeGOT .footer-style__FooterBlockTitle-sc-5e53f7f6-12{margin-bottom:15px;font-size:14px;}.cKeGOT .footer-style__LogoBlock-sc-5e53f7f6-3 .footer-style__Logo-sc-5e53f7f6-4{font-size:10px;line-height:12px;-webkit-letter-spacing:7%;-moz-letter-spacing:7%;-ms-letter-spacing:7%;letter-spacing:7%;width:30px;min-width:30px;height:30px;}.cKeGOT .footer-style__LogoBlock-sc-5e53f7f6-3 .footer-style__LogoMarketSubname-sc-5e53f7f6-6{font-size:11px;}.cKeGOT .footer-style__LogoBlock-sc-5e53f7f6-3 .footer-style__LogoDivider-sc-5e53f7f6-7{margin:0 8px;}.cKeGOT .footer-style__LogoBlock-sc-5e53f7f6-3 .footer-style__LogoMarketDescription-sc-5e53f7f6-8{font-size:12px;}.cKeGOT .footer-style__FooterTopSEO-sc-5e53f7f6-18{line-height:18px;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28{padding-top:35px;}}/*!sc*/
  193. @media (max-width:460px){.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28{-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;-webkit-align-items:flex-start;-webkit-box-align:flex-start;-ms-flex-align:flex-start;align-items:flex-start;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{width:100%;-webkit-order:0 !important;-ms-flex-order:0 !important;order:0 !important;margin:25px 0 0 0 !important;grid-template-columns:1fr 1fr;grid-column-gap:16px;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterLocation-sc-5e53f7f6-17{margin-top:0;margin-left:0;}.cKeGOT .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterSocials-sc-5e53f7f6-16{margin-bottom:25px;}}/*!sc*/
  194. data-styled.g113[id="footer-style__FooterTopContent-sc-5e53f7f6-29"]{content:"cKeGOT,"}/*!sc*/
  195. .dLSTHR{margin-top:100px;position:relative;}/*!sc*/
  196. @media (max-width:1000px){.dLSTHR .footer-style__FooterBottomContent-sc-5e53f7f6-2{padding-top:30px;position:relative;}.dLSTHR .footer-style__FooterBottomRight-sc-5e53f7f6-20{position:absolute;bottom:52px;right:0;}.dLSTHR .footer-style__FooterBottomLinks-sc-5e53f7f6-22{margin-top:20px;gap:20px;}.dLSTHR .footer-style__FooterNav-sc-5e53f7f6-10{margin-top:25px;}}/*!sc*/
  197. @media (max-width:802px){.dLSTHR .footer-style__FooterBottomLinks-sc-5e53f7f6-22{-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:flex-start;-webkit-box-align:flex-start;-ms-flex-align:flex-start;align-items:flex-start;}.dLSTHR .footer-style__FooterBottomLinks-sc-5e53f7f6-22 a{margin:0;}}/*!sc*/
  198. @media (max-width:662px){.dLSTHR .footer-style__FooterBottomRight-sc-5e53f7f6-20{width:100%;margin-top:20px;margin-left:0;position:static;-webkit-box-pack:start;-webkit-justify-content:flex-start;-ms-flex-pack:start;justify-content:flex-start;}.dLSTHR .footer-style__FooterBootomCopyright-sc-5e53f7f6-25{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:justify;-webkit-justify-content:space-between;-ms-flex-pack:justify;justify-content:space-between;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;width:100%;}.dLSTHR .footer-style__FooterBottomContent-sc-5e53f7f6-2{-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;}}/*!sc*/
  199. @media (max-width:505px){.dLSTHR .footer-style__FooterBottomContent-sc-5e53f7f6-2{padding-top:15px;padding-bottom:65px;}.dLSTHR .footer-style__FooterBottomLinks-sc-5e53f7f6-22{margin-top:15px;margin-bottom:0;gap:10px;}.dLSTHR .footer-style__FooterBottomText-sc-5e53f7f6-23{margin-top:15px;}.dLSTHR .footer-style__FooterBottomOffer-sc-5e53f7f6-21 br{display:block;}.dLSTHR .footer-style__FooterBootomCopyright-sc-5e53f7f6-25{margin-top:15px;}}/*!sc*/
  200. @media (max-width:483px){.dLSTHR{padding-bottom:40px;}.dLSTHR .footer-style__FooterTopContent-sc-5e53f7f6-29 .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{grid-template-columns:1fr 0.87fr 1.13fr;}}/*!sc*/
  201. @media (max-width:480px){.dLSTHR{margin-top:60px;}.dLSTHR .footer-style__FooterBottomLinks-sc-5e53f7f6-22{margin-bottom:0 !important;}.dLSTHR .footer-style__FooterBottomRight-sc-5e53f7f6-20{margin-top:0 !important;}}/*!sc*/
  202. @media (max-width:474px){.dLSTHR .footer-style__FooterTopContent-sc-5e53f7f6-29 .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{grid-template-columns:126px 107px 141px;}}/*!sc*/
  203. @media (max-width:445px){.dLSTHR .footer-style__FooterTopContent-sc-5e53f7f6-29 .footer-style__FooterTopContentFlex-sc-5e53f7f6-28 .footer-style__FooterNav-sc-5e53f7f6-10{grid-template-columns:1fr 1fr;grid-column-gap:30px;}}/*!sc*/
  204. data-styled.g114[id="footer-style__StyledFooter-sc-5e53f7f6-30"]{content:"dLSTHR,"}/*!sc*/
  205. .dhQWvG{display:none;}/*!sc*/
  206. @media (max-width:1000px){.dhQWvG{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;}.dhQWvG span{margin:0 !important;min-width:-webkit-max-content;min-width:-moz-max-content;min-width:max-content;}.dhQWvG a{margin-left:0;margin-top:0;}}/*!sc*/
  207. data-styled.g120[id="block-title-style__TitleResponsiveInfo-sc-2857f62c-0"]{content:"dhQWvG,"}/*!sc*/
  208. .fbLTvi{font-weight:500;font-size:30px;line-height:120%;color:#302e30;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;}/*!sc*/
  209. .fbLTvi span,.fbLTvi a{font-weight:400;font-size:14px;line-height:120%;color:#9ca0a9;}/*!sc*/
  210. .fbLTvi span{margin-left:16px;margin-bottom:4px;}/*!sc*/
  211. .fbLTvi a{-webkit-text-decoration-line:underline;text-decoration-line:underline;margin-top:5px;color:#E54E8D;-webkit-flex-basis:100%;-ms-flex-preferred-size:100%;flex-basis:100%;}/*!sc*/
  212. .fbLTvi a:hover{-webkit-text-decoration:none;text-decoration:none;}/*!sc*/
  213. @media (max-width:1000px){.fbLTvi{font-size:24px;line-height:28px;-webkit-box-pack:start;-webkit-justify-content:flex-start;-ms-flex-pack:start;justify-content:flex-start;}.fbLTvi .desktop{display:none;}.fbLTvi .block-title-style__TitleResponsiveInfo-sc-2857f62c-0{margin-left:15px;}}/*!sc*/
  214. @media (max-width:480px){.fbLTvi{font-size:20px;line-height:24px;}}/*!sc*/
  215. @media (max-width:370px){.fbLTvi{-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;-webkit-align-items:flex-start;-webkit-box-align:flex-start;-ms-flex-align:flex-start;align-items:flex-start;}.fbLTvi a{margin-top:5px;margin-left:0;}}/*!sc*/
  216. data-styled.g121[id="block-title-style__Title-sc-2857f62c-1"]{content:"fbLTvi,"}/*!sc*/
  217. .hvIkig{margin-top:80px;display:block;}/*!sc*/
  218. .hvIkig .block-title__BlockTitle-sc-1541926b-0{margin-bottom:40px;}/*!sc*/
  219. @media (max-width:1000px){.hvIkig{margin-top:50px;}.hvIkig .block-title__BlockTitle-sc-1541926b-0{margin-bottom:35px;}}/*!sc*/
  220. @media (max-width:480px){.hvIkig{margin-top:35px;}.hvIkig .block-title__BlockTitle-sc-1541926b-0{margin-bottom:25px;}}/*!sc*/
  221. data-styled.g123[id="common-block-with-title__StyledCommonBlock-sc-fe9ea2ff-0"]{content:"hvIkig,"}/*!sc*/
  222. .kHkRcX{width:184px;height:126px;-webkit-flex-shrink:0;-ms-flex-negative:0;flex-shrink:0;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;padding-left:40px;position:relative;}/*!sc*/
  223. @media (max-width:1237px){.kHkRcX{width:127px;padding-left:20px;}}/*!sc*/
  224. data-styled.g124[id="how-it-works-style__HowItWorksTriangle-sc-f9edb6e1-0"]{content:"kHkRcX,"}/*!sc*/
  225. .esRpOA{position:absolute;top:0;left:0;z-index:0;}/*!sc*/
  226. data-styled.g125[id="how-it-works-style__HowItWorksTriangleSvg-sc-f9edb6e1-1"]{content:"esRpOA,"}/*!sc*/
  227. .keDHIC{font-size:18px;line-height:120%;color:#ffffff;width:81px;z-index:1;}/*!sc*/
  228. @media (max-width:1237px){.keDHIC{font-size:15px;}}/*!sc*/
  229. data-styled.g126[id="how-it-works-style__HowItWorksTriangleText-sc-f9edb6e1-2"]{content:"keDHIC,"}/*!sc*/
  230. .bIUEdV{-webkit-align-self:flex-start;-ms-flex-item-align:start;align-self:flex-start;}/*!sc*/
  231. data-styled.g127[id="how-it-works-style__HowItWorksElementLeft-sc-f9edb6e1-3"]{content:"bIUEdV,"}/*!sc*/
  232. .gyJMYo{margin-left:16px;}/*!sc*/
  233. data-styled.g128[id="how-it-works-style__HowItWorksElementRight-sc-f9edb6e1-4"]{content:"gyJMYo,"}/*!sc*/
  234. .gijAsE{width:36px;height:36px;background:#fafafa;border-radius:50%;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;font-size:17px;color:#e54e8d;}/*!sc*/
  235. data-styled.g129[id="how-it-works-style__HowItWorksElementIcon-sc-f9edb6e1-5"]{content:"gijAsE,"}/*!sc*/
  236. .brjPc{font-size:17px;line-height:120%;color:#302E30;margin-top:8px;}/*!sc*/
  237. data-styled.g130[id="how-it-works-style__HowItWorksElementTitle-sc-f9edb6e1-6"]{content:"brjPc,"}/*!sc*/
  238. .cOllkA{font-size:14px;line-height:140%;color:#9CA0A9;margin-top:10px;max-width:250px;}/*!sc*/
  239. data-styled.g131[id="how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7"]{content:"cOllkA,"}/*!sc*/
  240. .bToiCo{width:1px;height:68px;background:#f6f5f7;margin-left:35px;margin-right:35px;}/*!sc*/
  241. data-styled.g132[id="how-it-works-style__HowItWorksElementDivider-sc-f9edb6e1-8"]{content:"bToiCo,"}/*!sc*/
  242. .clibUU{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;height:74px;}/*!sc*/
  243. @media (max-width:1191px){.clibUU .how-it-works-style__HowItWorksElementIcon-sc-f9edb6e1-5{width:32px;height:32px;font-size:15px;}.clibUU .how-it-works-style__HowItWorksElementRight-sc-f9edb6e1-4{margin-left:12px;}.clibUU .how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7{margin-top:8px;font-size:13px;}.clibUU .how-it-works-style__HowItWorksElementTitle-sc-f9edb6e1-6{font-size:16px;}}/*!sc*/
  244. @media (max-width:1105px){.clibUU .how-it-works-style__HowItWorksElementTitle-sc-f9edb6e1-6{font-size:15px;}.clibUU .how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7{font-size:12px;}}/*!sc*/
  245. data-styled.g133[id="how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9"]{content:"clibUU,"}/*!sc*/
  246. .eCgoaJ{padding-top:20px;padding-bottom:34px;margin-left:60px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:flex-start;-webkit-box-align:flex-start;-ms-flex-align:flex-start;align-items:flex-start;}/*!sc*/
  247. data-styled.g136[id="how-it-works-style__HowItWorksElements-sc-f9edb6e1-12"]{content:"eCgoaJ,"}/*!sc*/
  248. @media (max-width:480px){.jDHRkz{display:block;background-color:#fff;}}/*!sc*/
  249. data-styled.g137[id="how-it-works-style__HowItWorksWrapper-sc-f9edb6e1-13"]{content:"jDHRkz,"}/*!sc*/
  250. .gGgWWt{width:100%;background:#ffffff;box-shadow:0px 2px 12px rgba(99,47,117,0.09);border-radius:3px;height:126px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;margin-top:-63px;position:relative;z-index:1;margin-bottom:80px;}/*!sc*/
  251. @media (max-width:1429px){.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12{margin-left:50px;}.gGgWWt .how-it-works-style__HowItWorksElementDivider-sc-f9edb6e1-8{margin:0 40px;}}/*!sc*/
  252. @media (max-width:1418px){.gGgWWt .how-it-works-style__HowItWorksElementDivider-sc-f9edb6e1-8{margin:0 20px;}}/*!sc*/
  253. @media (max-width:1250px){.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12{margin-left:20px;padding-right:34px;}.gGgWWt .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9:not(:last-child){margin-right:20px;}}/*!sc*/
  254. @media (max-width:1105px){.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12{padding-top:25px;padding-bottom:33px;margin-left:15px;}.gGgWWt .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9:first-child{max-width:209px;}.gGgWWt .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9:nth-child(2){max-width:244px;}.gGgWWt .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9:last-child{max-width:274px;}}/*!sc*/
  255. @media (max-width:1000px){.gGgWWt{margin-bottom:35px;}}/*!sc*/
  256. @media (max-width:986px){.gGgWWt{box-shadow:none;background:none;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;overflow:auto;width:calc(100% + 60px);position:relative;left:-30px;padding:25px;margin-bottom:10px;height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;}.gGgWWt.mainPage{margin-top:10px;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12{margin:0;padding:0;-webkit-flex-wrap:nowrap;-ms-flex-wrap:nowrap;flex-wrap:nowrap;width:100%;height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;-webkit-box-pack:start;-webkit-justify-content:flex-start;-ms-flex-pack:start;justify-content:flex-start;gap:15px;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9{-webkit-flex-basis:33%;-ms-flex-preferred-size:33%;flex-basis:33%;padding:20px 20px 30px 20px;margin-right:0;height:160px;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;background:#ffffff;box-shadow:0px 2px 25px rgba(49,18,59,0.08);border-radius:3px;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9:first-child .how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7{max-width:100%;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9:last-child .how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7{max-width:100%;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 .how-it-works-style__HowItWorksElementRight-sc-f9edb6e1-4{width:100%;margin-left:0;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 .how-it-works-style__HowItWorksElementTitle-sc-f9edb6e1-6{margin-top:15px;font-size:17px;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 .how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7{margin-top:10px;font-size:14px;max-width:100%;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 .how-it-works-style__HowItWorksElementIcon-sc-f9edb6e1-5{width:30px;height:30px;font-size:15px;line-height:13px;}}/*!sc*/
  257. @media (max-width:986px){.gGgWWt{margin-top:-85px;margin-bottom:25px;-ms-overflow-style:none;-webkit-scrollbar-width:none;-moz-scrollbar-width:none;-ms-scrollbar-width:none;scrollbar-width:none;}.gGgWWt::-webkit-scrollbar{width:0;height:0;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9{min-width:303px;}}/*!sc*/
  258. @media (max-width:882px){.gGgWWt{width:calc(100% + 60px);position:relative;left:-30px;padding:25px 30px;}.gGgWWt .how-it-works-style__HowItWorksElements-sc-f9edb6e1-12{width:-webkit-fit-content;width:-moz-fit-content;width:fit-content;}}/*!sc*/
  259. @media (max-width:768px){.gGgWWt{margin-top:-16px;}}/*!sc*/
  260. @media (max-width:600px){.gGgWWt{width:calc(100% + 40px);left:-20px;padding:25px 20px;margin-bottom:10px;}.gGgWWt.mainPage{margin-bottom:25px;}}/*!sc*/
  261. @media (max-width:480px){.gGgWWt.mainPage{margin-top:0;margin-bottom:0;padding-top:20px;padding-bottom:35px;}.gGgWWt.mainPage .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9{padding-bottom:25px;height:139px;}.gGgWWt.mainPage .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 .how-it-works-style__HowItWorksElementTitle-sc-f9edb6e1-6{margin-top:12px;font-size:15px;}.gGgWWt.mainPage .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 .how-it-works-style__HowItWorksElementIcon-sc-f9edb6e1-5{width:20px;height:20px;font-size:11px;font-weight:700;}.gGgWWt.mainPage .how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 .how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7{margin-top:8px;font-size:13px;}}/*!sc*/
  262. data-styled.g139[id="how-it-works-style__StyledHowItWorks-sc-f9edb6e1-15"]{content:"gGgWWt,"}/*!sc*/
  263. .OyqUG{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-flex-shrink:0;-ms-flex-negative:0;flex-shrink:0;font-size:15px;padding:3px 5px;}/*!sc*/
  264. .OyqUG.circle{border-radius:50%;}/*!sc*/
  265. .OyqUG.rounded{border:1px solid #e64e8d;border-radius:3px;color:#E54E8D;}/*!sc*/
  266. .OyqUG.rounded svg{width:100%;height:auto;}/*!sc*/
  267. .OyqUG.rounded.fill{background:#e64e8d;color:white;}/*!sc*/
  268. .OyqUG.rounded.secondary{border-color:#27ae60;color:#27ae60;}/*!sc*/
  269. .OyqUG.rounded.secondary.fill{background-color:transparent;color:#27ae60;}/*!sc*/
  270. .OyqUG.rounded:hover{border-color:#f25292;background:#f25292;color:white;}/*!sc*/
  271. .OyqUG.rounded:hover.secondary{background:#27ae60;border-color:#27ae60;color:white;}/*!sc*/
  272. .OyqUG.rounded:hover.secondary.fill{background:#27ae60;color:white;}/*!sc*/
  273. .OyqUG:disabled{color:#9ca0a9;}/*!sc*/
  274. data-styled.g140[id="icon-button-style__Button-sc-4db2e416-0"]{content:"OyqUG,"}/*!sc*/
  275. .QGoTg{background:#ffffff;box-shadow:0px 2px 12px rgba(99,47,117,0.09);border-radius:50%;position:absolute;top:0;bottom:0;left:-60px;margin:auto;z-index:2;-webkit-transition:opacity ease 0.3s;transition:opacity ease 0.3s;}/*!sc*/
  276. .QGoTg:disabled{background-color:#fff;}/*!sc*/
  277. .QGoTg:hover:not(:disabled){color:#E54E8D;}/*!sc*/
  278. data-styled.g141[id="bannder-slider-style__PrevSlide-sc-633dc9b1-0"]{content:"QGoTg,"}/*!sc*/
  279. .dkYIfc{background:#ffffff;box-shadow:0px 2px 12px rgba(99,47,117,0.09);border-radius:50%;position:absolute;top:0;bottom:0;right:-60px;margin:auto;z-index:2;-webkit-transition:opacity ease 0.3s;transition:opacity ease 0.3s;}/*!sc*/
  280. .dkYIfc:disabled{background-color:#fff;}/*!sc*/
  281. .dkYIfc:hover:not(:disabled){color:#E54E8D;}/*!sc*/
  282. data-styled.g142[id="bannder-slider-style__NextSlide-sc-633dc9b1-1"]{content:"dkYIfc,"}/*!sc*/
  283. .boDCLE{position:absolute;height:100%;width:100%;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;}/*!sc*/
  284. .boDCLE .wrapper-style__Wrapper-sc-53eabab1-1{height:100%;position:relative;}/*!sc*/
  285. @media (max-width:1655px){.boDCLE .bannder-slider-style__NextSlide-sc-633dc9b1-1{right:-30px;}.boDCLE .bannder-slider-style__PrevSlide-sc-633dc9b1-0{left:-30px;}}/*!sc*/
  286. @media (max-width:1584px){.boDCLE .bannder-slider-style__NextSlide-sc-633dc9b1-1{right:-15px;}.boDCLE .bannder-slider-style__PrevSlide-sc-633dc9b1-0{left:-15px;}}/*!sc*/
  287. @media (max-width:1546px){.boDCLE .bannder-slider-style__NextSlide-sc-633dc9b1-1{right:-5px;}.boDCLE .bannder-slider-style__PrevSlide-sc-633dc9b1-0{left:-5px;}}/*!sc*/
  288. @media (max-width:1482px){.boDCLE .bannder-slider-style__NextSlide-sc-633dc9b1-1{right:0;}.boDCLE .bannder-slider-style__PrevSlide-sc-633dc9b1-0{left:0;}}/*!sc*/
  289. data-styled.g143[id="bannder-slider-style__ArrowsContainer-sc-633dc9b1-2"]{content:"boDCLE,"}/*!sc*/
  290. .vrCjr{position:relative;overflow-x:visible;}/*!sc*/
  291. .vrCjr:hover .bannder-slider-style__PrevSlide-sc-633dc9b1-0,.vrCjr:hover .bannder-slider-style__NextSlide-sc-633dc9b1-1{opacity:1;}/*!sc*/
  292. .vrCjr .swiper-pagination{bottom:82px;}/*!sc*/
  293. .vrCjr .swiper-pagination .swiper-pagination-bullet{width:9px;height:9px;opacity:1;margin-left:8px;margin-right:8px;background:#d9dde7;}/*!sc*/
  294. .vrCjr .swiper-pagination .swiper-pagination-bullet:hover{background:#9ca0a9;}/*!sc*/
  295. .vrCjr .swiper-pagination .swiper-pagination-bullet.swiper-pagination-bullet-active{background:#e64e8d;}/*!sc*/
  296. @media (max-width:1275px){.vrCjr .swiper-pagination{bottom:75px;}}/*!sc*/
  297. @media (max-width:1250px){.vrCjr .bannder-slider-style__PrevSlide-sc-633dc9b1-0,.vrCjr .bannder-slider-style__NextSlide-sc-633dc9b1-1{display:none;}}/*!sc*/
  298. @media (max-width:1000px){.vrCjr .swiper-pagination .swiper-pagination-bullet{margin-right:16px;margin-left:0;}.vrCjr .swiper-pagination .swiper-pagination-bullet:last-child{margin-right:0;}}/*!sc*/
  299. @media (max-width:813px){.vrCjr .swiper-pagination{bottom:30px;}}/*!sc*/
  300. @media (max-width:480px){.vrCjr .swiper-pagination{bottom:25px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;height:6px;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;}.vrCjr .swiper-pagination .swiper-pagination-bullet{height:6px;width:6px;background-color:#9ca0a9;}}/*!sc*/
  301. data-styled.g145[id="bannder-slider-style__StyledBannderSlider-sc-633dc9b1-4"]{content:"vrCjr,"}/*!sc*/
  302. .kbDXsX{position:relative;padding-top:84px;height:560px;}/*!sc*/
  303. data-styled.g146[id="banner-slide-style__Relative-sc-184eb57d-0"]{content:"kbDXsX,"}/*!sc*/
  304. .jxSkLT{z-index:2;}/*!sc*/
  305. data-styled.g147[id="banner-slide-style__SlideLeft-sc-184eb57d-1"]{content:"jxSkLT,"}/*!sc*/
  306. .irkRbX{width:-webkit-fit-content;width:-moz-fit-content;width:fit-content;font-weight:500;font-size:34px;z-index:2;line-height:120%;color:#E54E8D;position:relative;}/*!sc*/
  307. .irkRbX span{color:#302E30;}/*!sc*/
  308. @media (max-width:560px){.irkRbX{margin-left:5px;display:inline;}.irkRbX span{display:block;}}/*!sc*/
  309. @media (max-width:480px){.irkRbX.first{margin-left:0;}}/*!sc*/
  310. data-styled.g148[id="banner-slide-style__SlideSubtitle-sc-184eb57d-2"]{content:"irkRbX,"}/*!sc*/
  311. .iAhzWd{font-weight:500;font-size:34px;line-height:120%;color:#302E30;}/*!sc*/
  312. @media (max-width:560px){.iAhzWd.noMargin .banner-slide-style__SlideSubtitle-sc-184eb57d-2{margin:0;display:block;}}/*!sc*/
  313. @media (max-width:480px){.iAhzWd{max-width:320px;}.iAhzWd.flex{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;}}/*!sc*/
  314. data-styled.g149[id="banner-slide-style__SlideTitle-sc-184eb57d-3"]{content:"iAhzWd,"}/*!sc*/
  315. .kNzOMw{font-weight:500;font-size:34px;line-height:120%;color:#302E30;}/*!sc*/
  316. @media (max-width:560px){.kNzOMw.noMargin .banner-slide-style__SlideSubtitle-sc-184eb57d-2{margin:0;display:block;}}/*!sc*/
  317. @media (max-width:480px){.kNzOMw{max-width:320px;}.kNzOMw.flex{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;}}/*!sc*/
  318. data-styled.g150[id="banner-slide-style__FirstSlideTitle-sc-184eb57d-4"]{content:"kNzOMw,"}/*!sc*/
  319. .cjfsRf{margin-top:30px;}/*!sc*/
  320. data-styled.g151[id="banner-slide-style__SlideFeatures-sc-184eb57d-5"]{content:"cjfsRf,"}/*!sc*/
  321. .ZiecM{margin-top:30px;font-weight:400;font-size:15px;line-height:160%;color:#686A70;max-width:650px;}/*!sc*/
  322. data-styled.g152[id="banner-slide-style__SlideText-sc-184eb57d-6"]{content:"ZiecM,"}/*!sc*/
  323. .ymxBq{margin-top:20px;display:none;width:100%;height:20px;}/*!sc*/
  324. data-styled.g153[id="banner-slide-style__SlideFakePagination-sc-184eb57d-7"]{content:"ymxBq,"}/*!sc*/
  325. .kKYSjk{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;font-size:15px;line-height:140%;color:#686A70;}/*!sc*/
  326. .kKYSjk:not(:first-child){margin-top:9px;}/*!sc*/
  327. data-styled.g154[id="banner-slide-style__SlideFeature-sc-184eb57d-8"]{content:"kKYSjk,"}/*!sc*/
  328. .jObpwA{display:inline-block;margin-top:32px;}/*!sc*/
  329. data-styled.g155[id="banner-slide-style__SlideButton-sc-184eb57d-9"]{content:"jObpwA,"}/*!sc*/
  330. .bpZnNT{position:absolute;height:100%;width:700px;right:0;bottom:0;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;z-index:0;}/*!sc*/
  331. data-styled.g156[id="banner-slide-style__Illustration-sc-184eb57d-10"]{content:"bpZnNT,"}/*!sc*/
  332. .frbYED{position:relative;height:560px;overflow:hidden;background-color:#F4F2FA;}/*!sc*/
  333. @media (max-width:1250px){.frbYED{height:470px;}.frbYED .banner-slide-style__SlideTitle-sc-184eb57d-3,.frbYED .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.frbYED .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:30px;}.frbYED .banner-slide-style__SlideFeature-sc-184eb57d-8,.frbYED .banner-slide-style__SlideText-sc-184eb57d-6{font-size:14px;}.frbYED .banner-slide-style__Relative-sc-184eb57d-0{padding-top:40px;}}/*!sc*/
  334. @media (max-width:1170px){.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{width:600px;}}/*!sc*/
  335. @media (max-width:1000px){.frbYED{height:470px;}.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{width:530px;bottom:-70px;}.frbYED .banner-slide-style__SlideText-sc-184eb57d-6{max-width:450px;}.frbYED .banner-slide-style__Relative-sc-184eb57d-0{height:390px;}}/*!sc*/
  336. @media (max-width:976px){.frbYED{height:390px;}}/*!sc*/
  337. @media (max-width:813px){.frbYED .banner-slide-style__SlideLeft-sc-184eb57d-1{z-index:2;}.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{width:370px;bottom:-13px;}}/*!sc*/
  338. @media (max-width:754px){.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{width:330px;bottom:-20px;}}/*!sc*/
  339. @media (max-width:768px){.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{height:288px;}}/*!sc*/
  340. @media (max-width:745px){.frbYED{height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;}.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{height:auto;}}/*!sc*/
  341. @media (max-width:703px){.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{width:350px;bottom:0;}.frbYED .banner-slide-style__SlideFeatures-sc-184eb57d-5,.frbYED .banner-slide-style__SlideText-sc-184eb57d-6{display:none;}.frbYED height:340px .banner-slide-style__Relative-sc-184eb57d-0{height:340px;}}/*!sc*/
  342. @media (max-width:665px){.frbYED .banner-slide-style__SlideTitle-sc-184eb57d-3 .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.frbYED .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:28px;}.frbYED .banner-slide-style__SlideFeature-sc-184eb57d-8:not(:first-child){margin-top:2px;}}/*!sc*/
  343. @media (max-width:558px){.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{width:300px;}}/*!sc*/
  344. @media (max-width:480px){.frbYED{text-align:left;min-height:266px;height:-webkit-max-content;height:-moz-max-content;height:max-content;padding-top:30px;padding-bottom:15px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;}.frbYED .banner-slide-style__Relative-sc-184eb57d-0{padding-top:0;height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;}.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{bottom:unset;top:-45px;right:0;width:241px;}.frbYED.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{top:-65px;}.frbYED.slide-0 .banner-slide-style__SlideButton-sc-184eb57d-9{margin-top:30px;}.frbYED.slide-1 .banner-slide-style__Illustration-sc-184eb57d-10{top:-52px;}.frbYED.slide-2 .banner-slide-style__Illustration-sc-184eb57d-10{top:-35px;}.frbYED.slide-3 .banner-slide-style__Illustration-sc-184eb57d-10{top:-49px;}.frbYED .banner-slide-style__SlideText-sc-184eb57d-6,.frbYED .banner-slide-style__SlideFeatures-sc-184eb57d-5{display:none;}.frbYED .banner-slide-style__SlideLeft-sc-184eb57d-1{height:195px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;-webkit-align-items:flex-start;-webkit-box-align:flex-start;-ms-flex-align:flex-start;align-items:flex-start;-webkit-box-pack:end;-webkit-justify-content:flex-end;-ms-flex-pack:end;justify-content:flex-end;}.frbYED .banner-slide-style__SlideButton-sc-184eb57d-9{margin-bottom:40px;margin-top:54px;width:100%;}.frbYED .banner-slide-style__SlideButton-sc-184eb57d-9 button{text-transform:none;font-size:14px;height:40px;}.frbYED .banner-slide-style__SlideTitle-sc-184eb57d-3,.frbYED .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.frbYED .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:18px;line-height:24px;}.frbYED .banner-slide-style__SlideTitle-sc-184eb57d-3,.frbYED .banner-slide-style__FirstSlideTitle-sc-184eb57d-4{max-width:215px;}}/*!sc*/
  345. @media (max-width:462px) and (min-width:443px){.frbYED.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{right:-20px;}}/*!sc*/
  346. @media (max-width:442px) and (min-width:409px){.frbYED.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{-webkit-transform:scale(0.8);-ms-transform:scale(0.8);transform:scale(0.8);top:-47px;right:-40px;}}/*!sc*/
  347. @media (max-width:408px){.frbYED{min-height:266px;}.frbYED.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{top:-48px;right:-40px;}.frbYED.slide-1 .banner-slide-style__Illustration-sc-184eb57d-10{top:-36px;right:-25px;}.frbYED.slide-2 .banner-slide-style__Illustration-sc-184eb57d-10{top:-21px;right:-25px;}.frbYED.slide-3 .banner-slide-style__Illustration-sc-184eb57d-10{top:-34px;right:-20px;}.frbYED .banner-slide-style__SlideTitle-sc-184eb57d-3,.frbYED .banner-slide-style__FirstSlideTitle-sc-184eb57d-4{max-width:176px;font-size:18px;}.frbYED .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:18px;}.frbYED .banner-slide-style__Illustration-sc-184eb57d-10{width:219px;height:163px;}}/*!sc*/
  348. .fshcKV{position:relative;height:560px;overflow:hidden;background-color:#F9F5FA;}/*!sc*/
  349. @media (max-width:1250px){.fshcKV{height:470px;}.fshcKV .banner-slide-style__SlideTitle-sc-184eb57d-3,.fshcKV .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.fshcKV .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:30px;}.fshcKV .banner-slide-style__SlideFeature-sc-184eb57d-8,.fshcKV .banner-slide-style__SlideText-sc-184eb57d-6{font-size:14px;}.fshcKV .banner-slide-style__Relative-sc-184eb57d-0{padding-top:40px;}}/*!sc*/
  350. @media (max-width:1170px){.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{width:600px;}}/*!sc*/
  351. @media (max-width:1000px){.fshcKV{height:470px;}.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{width:530px;bottom:-70px;}.fshcKV .banner-slide-style__SlideText-sc-184eb57d-6{max-width:450px;}.fshcKV .banner-slide-style__Relative-sc-184eb57d-0{height:390px;}}/*!sc*/
  352. @media (max-width:976px){.fshcKV{height:390px;}}/*!sc*/
  353. @media (max-width:813px){.fshcKV .banner-slide-style__SlideLeft-sc-184eb57d-1{z-index:2;}.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{width:370px;bottom:-13px;}}/*!sc*/
  354. @media (max-width:754px){.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{width:330px;bottom:-20px;}}/*!sc*/
  355. @media (max-width:768px){.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{height:288px;}}/*!sc*/
  356. @media (max-width:745px){.fshcKV{height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;}.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{height:auto;}}/*!sc*/
  357. @media (max-width:703px){.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{width:350px;bottom:0;}.fshcKV .banner-slide-style__SlideFeatures-sc-184eb57d-5,.fshcKV .banner-slide-style__SlideText-sc-184eb57d-6{display:none;}.fshcKV height:340px .banner-slide-style__Relative-sc-184eb57d-0{height:340px;}}/*!sc*/
  358. @media (max-width:665px){.fshcKV .banner-slide-style__SlideTitle-sc-184eb57d-3 .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.fshcKV .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:28px;}.fshcKV .banner-slide-style__SlideFeature-sc-184eb57d-8:not(:first-child){margin-top:2px;}}/*!sc*/
  359. @media (max-width:558px){.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{width:300px;}}/*!sc*/
  360. @media (max-width:480px){.fshcKV{text-align:left;min-height:266px;height:-webkit-max-content;height:-moz-max-content;height:max-content;padding-top:30px;padding-bottom:15px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;}.fshcKV .banner-slide-style__Relative-sc-184eb57d-0{padding-top:0;height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;}.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{bottom:unset;top:-45px;right:0;width:241px;}.fshcKV.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{top:-65px;}.fshcKV.slide-0 .banner-slide-style__SlideButton-sc-184eb57d-9{margin-top:30px;}.fshcKV.slide-1 .banner-slide-style__Illustration-sc-184eb57d-10{top:-52px;}.fshcKV.slide-2 .banner-slide-style__Illustration-sc-184eb57d-10{top:-35px;}.fshcKV.slide-3 .banner-slide-style__Illustration-sc-184eb57d-10{top:-49px;}.fshcKV .banner-slide-style__SlideText-sc-184eb57d-6,.fshcKV .banner-slide-style__SlideFeatures-sc-184eb57d-5{display:none;}.fshcKV .banner-slide-style__SlideLeft-sc-184eb57d-1{height:195px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;-webkit-align-items:flex-start;-webkit-box-align:flex-start;-ms-flex-align:flex-start;align-items:flex-start;-webkit-box-pack:end;-webkit-justify-content:flex-end;-ms-flex-pack:end;justify-content:flex-end;}.fshcKV .banner-slide-style__SlideButton-sc-184eb57d-9{margin-bottom:40px;margin-top:54px;width:100%;}.fshcKV .banner-slide-style__SlideButton-sc-184eb57d-9 button{text-transform:none;font-size:14px;height:40px;}.fshcKV .banner-slide-style__SlideTitle-sc-184eb57d-3,.fshcKV .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.fshcKV .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:18px;line-height:24px;}.fshcKV .banner-slide-style__SlideTitle-sc-184eb57d-3,.fshcKV .banner-slide-style__FirstSlideTitle-sc-184eb57d-4{max-width:215px;}}/*!sc*/
  361. @media (max-width:462px) and (min-width:443px){.fshcKV.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{right:-20px;}}/*!sc*/
  362. @media (max-width:442px) and (min-width:409px){.fshcKV.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{-webkit-transform:scale(0.8);-ms-transform:scale(0.8);transform:scale(0.8);top:-47px;right:-40px;}}/*!sc*/
  363. @media (max-width:408px){.fshcKV{min-height:266px;}.fshcKV.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{top:-48px;right:-40px;}.fshcKV.slide-1 .banner-slide-style__Illustration-sc-184eb57d-10{top:-36px;right:-25px;}.fshcKV.slide-2 .banner-slide-style__Illustration-sc-184eb57d-10{top:-21px;right:-25px;}.fshcKV.slide-3 .banner-slide-style__Illustration-sc-184eb57d-10{top:-34px;right:-20px;}.fshcKV .banner-slide-style__SlideTitle-sc-184eb57d-3,.fshcKV .banner-slide-style__FirstSlideTitle-sc-184eb57d-4{max-width:176px;font-size:18px;}.fshcKV .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:18px;}.fshcKV .banner-slide-style__Illustration-sc-184eb57d-10{width:219px;height:163px;}}/*!sc*/
  364. .fsIrff{position:relative;height:560px;overflow:hidden;background-color:#F2F8FA;}/*!sc*/
  365. @media (max-width:1250px){.fsIrff{height:470px;}.fsIrff .banner-slide-style__SlideTitle-sc-184eb57d-3,.fsIrff .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.fsIrff .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:30px;}.fsIrff .banner-slide-style__SlideFeature-sc-184eb57d-8,.fsIrff .banner-slide-style__SlideText-sc-184eb57d-6{font-size:14px;}.fsIrff .banner-slide-style__Relative-sc-184eb57d-0{padding-top:40px;}}/*!sc*/
  366. @media (max-width:1170px){.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{width:600px;}}/*!sc*/
  367. @media (max-width:1000px){.fsIrff{height:470px;}.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{width:530px;bottom:-70px;}.fsIrff .banner-slide-style__SlideText-sc-184eb57d-6{max-width:450px;}.fsIrff .banner-slide-style__Relative-sc-184eb57d-0{height:390px;}}/*!sc*/
  368. @media (max-width:976px){.fsIrff{height:390px;}}/*!sc*/
  369. @media (max-width:813px){.fsIrff .banner-slide-style__SlideLeft-sc-184eb57d-1{z-index:2;}.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{width:370px;bottom:-13px;}}/*!sc*/
  370. @media (max-width:754px){.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{width:330px;bottom:-20px;}}/*!sc*/
  371. @media (max-width:768px){.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{height:288px;}}/*!sc*/
  372. @media (max-width:745px){.fsIrff{height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;}.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{height:auto;}}/*!sc*/
  373. @media (max-width:703px){.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{width:350px;bottom:0;}.fsIrff .banner-slide-style__SlideFeatures-sc-184eb57d-5,.fsIrff .banner-slide-style__SlideText-sc-184eb57d-6{display:none;}.fsIrff height:340px .banner-slide-style__Relative-sc-184eb57d-0{height:340px;}}/*!sc*/
  374. @media (max-width:665px){.fsIrff .banner-slide-style__SlideTitle-sc-184eb57d-3 .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.fsIrff .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:28px;}.fsIrff .banner-slide-style__SlideFeature-sc-184eb57d-8:not(:first-child){margin-top:2px;}}/*!sc*/
  375. @media (max-width:558px){.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{width:300px;}}/*!sc*/
  376. @media (max-width:480px){.fsIrff{text-align:left;min-height:266px;height:-webkit-max-content;height:-moz-max-content;height:max-content;padding-top:30px;padding-bottom:15px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;}.fsIrff .banner-slide-style__Relative-sc-184eb57d-0{padding-top:0;height:-webkit-fit-content;height:-moz-fit-content;height:fit-content;}.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{bottom:unset;top:-45px;right:0;width:241px;}.fsIrff.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{top:-65px;}.fsIrff.slide-0 .banner-slide-style__SlideButton-sc-184eb57d-9{margin-top:30px;}.fsIrff.slide-1 .banner-slide-style__Illustration-sc-184eb57d-10{top:-52px;}.fsIrff.slide-2 .banner-slide-style__Illustration-sc-184eb57d-10{top:-35px;}.fsIrff.slide-3 .banner-slide-style__Illustration-sc-184eb57d-10{top:-49px;}.fsIrff .banner-slide-style__SlideText-sc-184eb57d-6,.fsIrff .banner-slide-style__SlideFeatures-sc-184eb57d-5{display:none;}.fsIrff .banner-slide-style__SlideLeft-sc-184eb57d-1{height:195px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;-webkit-align-items:flex-start;-webkit-box-align:flex-start;-ms-flex-align:flex-start;align-items:flex-start;-webkit-box-pack:end;-webkit-justify-content:flex-end;-ms-flex-pack:end;justify-content:flex-end;}.fsIrff .banner-slide-style__SlideButton-sc-184eb57d-9{margin-bottom:40px;margin-top:54px;width:100%;}.fsIrff .banner-slide-style__SlideButton-sc-184eb57d-9 button{text-transform:none;font-size:14px;height:40px;}.fsIrff .banner-slide-style__SlideTitle-sc-184eb57d-3,.fsIrff .banner-slide-style__FirstSlideTitle-sc-184eb57d-4,.fsIrff .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:18px;line-height:24px;}.fsIrff .banner-slide-style__SlideTitle-sc-184eb57d-3,.fsIrff .banner-slide-style__FirstSlideTitle-sc-184eb57d-4{max-width:215px;}}/*!sc*/
  377. @media (max-width:462px) and (min-width:443px){.fsIrff.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{right:-20px;}}/*!sc*/
  378. @media (max-width:442px) and (min-width:409px){.fsIrff.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{-webkit-transform:scale(0.8);-ms-transform:scale(0.8);transform:scale(0.8);top:-47px;right:-40px;}}/*!sc*/
  379. @media (max-width:408px){.fsIrff{min-height:266px;}.fsIrff.slide-0 .banner-slide-style__Illustration-sc-184eb57d-10{top:-48px;right:-40px;}.fsIrff.slide-1 .banner-slide-style__Illustration-sc-184eb57d-10{top:-36px;right:-25px;}.fsIrff.slide-2 .banner-slide-style__Illustration-sc-184eb57d-10{top:-21px;right:-25px;}.fsIrff.slide-3 .banner-slide-style__Illustration-sc-184eb57d-10{top:-34px;right:-20px;}.fsIrff .banner-slide-style__SlideTitle-sc-184eb57d-3,.fsIrff .banner-slide-style__FirstSlideTitle-sc-184eb57d-4{max-width:176px;font-size:18px;}.fsIrff .banner-slide-style__SlideSubtitle-sc-184eb57d-2{font-size:18px;}.fsIrff .banner-slide-style__Illustration-sc-184eb57d-10{width:219px;height:163px;}}/*!sc*/
  380. data-styled.g157[id="banner-slide-style__StyledBannerSlide-sc-184eb57d-11"]{content:"frbYED,fshcKV,fsIrff,"}/*!sc*/
  381. .gvOvZw{width:100%;height:74px;position:fixed;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:space-around;-webkit-justify-content:space-around;-ms-flex-pack:space-around;justify-content:space-around;bottom:0;box-shadow:0px -1px 12px rgba(118,104,122,0.15);z-index:6;background:white;padding:0px 16px;display:none;}/*!sc*/
  382. @media (max-width:992px){.gvOvZw{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;}}/*!sc*/
  383. @media (max-width:480px){.gvOvZw{height:68px;}}/*!sc*/
  384. data-styled.g158[id="tap-bar-style__StyledTapBar-sc-b7c948cf-0"]{content:"gvOvZw,"}/*!sc*/
  385. .jaJEkZ{position:relative;}/*!sc*/
  386. .jaJEkZ svg{width:30px;height:30px;}/*!sc*/
  387. data-styled.g159[id="tap-bar-style__TapBarItemIcon-sc-b7c948cf-1"]{content:"jaJEkZ,"}/*!sc*/
  388. .ksGZja{font-size:12px;color:#686A70;}/*!sc*/
  389. data-styled.g161[id="tap-bar-style__TapBarItemText-sc-b7c948cf-3"]{content:"ksGZja,"}/*!sc*/
  390. .hhKyke{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;}/*!sc*/
  391. .hhKyke .tap-bar-style__TapBarItemIcon-sc-b7c948cf-1{color:black;}/*!sc*/
  392. .hhKyke .tap-bar-style__TapBarItemIcon-sc-b7c948cf-1 svg path,.hhKyke .tap-bar-style__TapBarItemIcon-sc-b7c948cf-1 svg rect{fill:black;}/*!sc*/
  393. .hhKyke .tap-bar-style__TapBarItemText-sc-b7c948cf-3{color:#686A70;}/*!sc*/
  394. data-styled.g162[id="tap-bar-style__TapBarItem-sc-b7c948cf-4"]{content:"hhKyke,"}/*!sc*/
  395. .fJSRMI{margin-left:5px;font-size:13px;text-align:center;position:relative;color:#302e30;}/*!sc*/
  396. @media (max-width:1000px){.fJSRMI{font-size:12px;}}/*!sc*/
  397. data-styled.g192[id="rating-stars-style__RatingNumber-sc-a59b5b95-0"]{content:"fJSRMI,"}/*!sc*/
  398. .dqmnnP{margin-left:6px;font-size:12px;color:#9ca0a9;}/*!sc*/
  399. data-styled.g193[id="rating-stars-style__Votes-sc-a59b5b95-1"]{content:"dqmnnP,"}/*!sc*/
  400. .dycFDI{padding-bottom:19px;display:block;position:relative;width:113px;min-width:113px;height:16px;background-repeat:no-repeat;background-image:url("data:image/svg+xml,%3Csvg width='114' height='18' viewBox='0 0 114 18' fill='none' xmlns='http://www.w3.org/2000/svg'%3E%3Cpath d='M9 1.30198L10.9189 5.9155L11.0362 6.19748L11.3406 6.22188L16.3213 6.62118L12.5265 9.87179L12.2946 10.0705L12.3654 10.3675L13.5248 15.2278L9.26063 12.6233L9 12.4641L8.73937 12.6233L4.47522 15.2278L5.63458 10.3675L5.70544 10.0705L5.4735 9.87179L1.67875 6.62118L6.65943 6.22188L6.96385 6.19748L7.08113 5.9155L9 1.30198Z' stroke='%23D9DDE7'/%3E%3Cpath d='M33 1.30198L34.9189 5.9155L35.0362 6.19748L35.3406 6.22188L40.3213 6.62118L36.5265 9.87179L36.2946 10.0705L36.3654 10.3675L37.5248 15.2278L33.2606 12.6233L33 12.4641L32.7394 12.6233L28.4752 15.2278L29.6346 10.3675L29.7054 10.0705L29.4735 9.87179L25.6787 6.62118L30.6594 6.22188L30.9638 6.19748L31.0811 5.9155L33 1.30198Z' stroke='%23D9DDE7'/%3E%3Cpath d='M57 1.30198L58.9189 5.9155L59.0362 6.19748L59.3406 6.22188L64.3213 6.62118L60.5265 9.87179L60.2946 10.0705L60.3654 10.3675L61.5248 15.2278L57.2606 12.6233L57 12.4641L56.7394 12.6233L52.4752 15.2278L53.6346 10.3675L53.7054 10.0705L53.4735 9.87179L49.6787 6.62118L54.6594 6.22188L54.9638 6.19748L55.0811 5.9155L57 1.30198Z' stroke='%23D9DDE7'/%3E%3Cpath d='M81 1.30198L82.9189 5.9155L83.0362 6.19748L83.3406 6.22188L88.3213 6.62118L84.5265 9.87179L84.2946 10.0705L84.3654 10.3675L85.5248 15.2278L81.2606 12.6233L81 12.4641L80.7394 12.6233L76.4752 15.2278L77.6346 10.3675L77.7054 10.0705L77.4735 9.87179L73.6787 6.62118L78.6594 6.22188L78.9638 6.19748L79.0811 5.9155L81 1.30198Z' stroke='%23D9DDE7'/%3E%3Cpath d='M105 1.30198L106.919 5.9155L107.036 6.19748L107.341 6.22188L112.321 6.62118L108.527 9.87179L108.295 10.0705L108.365 10.3675L109.525 15.2278L105.261 12.6233L105 12.4641L104.739 12.6233L100.475 15.2278L101.635 10.3675L101.705 10.0705L101.473 9.87179L97.6787 6.62118L102.659 6.22188L102.964 6.19748L103.081 5.9155L105 1.30198Z' stroke='%23D9DDE7'/%3E%3C/svg%3E%0A");background-position:left top;background-size:100%;}/*!sc*/
  401. .dycFDI span span{display:block;position:relative;width:113px;min-width:113px;height:16px;background-repeat:no-repeat;background-image:url("data:image/svg+xml,%3Csvg width='113' height='16' viewBox='0 0 113 16' fill='none' xmlns='http://www.w3.org/2000/svg'%3E%3Cpath d='M8.94043 0L11.3044 5.62463L17.4404 6.11144L12.7655 10.0744L14.1938 16L8.94043 12.8246L3.68714 16L5.11543 10.0744L0.44043 6.11144L6.57645 5.62463L8.94043 0Z' fill='%23E64E8D'/%3E%3Cpath d='M32.5 0L34.864 5.62463L41 6.11144L36.325 10.0744L37.7533 16L32.5 12.8246L27.2467 16L28.675 10.0744L24 6.11144L30.136 5.62463L32.5 0Z' fill='%23E64E8D'/%3E%3Cpath d='M56.9404 0L59.3044 5.62463L65.4404 6.11144L60.7655 10.0744L62.1938 16L56.9404 12.8246L51.6871 16L53.1154 10.0744L48.4404 6.11144L54.5765 5.62463L56.9404 0Z' fill='%23E64E8D'/%3E%3Cpath d='M80.5 0L82.864 5.62463L89 6.11144L84.325 10.0744L85.7533 16L80.5 12.8246L75.2467 16L76.675 10.0744L72 6.11144L78.136 5.62463L80.5 0Z' fill='%23E64E8D'/%3E%3Cpath d='M104.5 0L106.864 5.62463L113 6.11144L108.325 10.0744L109.753 16L104.5 12.8246L99.2466 16L100.675 10.0744L96 6.11144L102.135 5.62463L104.5 0Z' fill='%23E64E8D'/%3E%3C/svg%3E");background-position:left top;background-size:100%;}/*!sc*/
  402. .dycFDI > span{display:block;position:absolute;top:0;left:0;height:100%;overflow:hidden;}/*!sc*/
  403. .dycFDI > span > span{background-image:url("data:image/svg+xml,%3Csvg width='114' height='18' viewBox='0 0 114 18' fill='none' xmlns='http://www.w3.org/2000/svg'%3E%3Cpath d='M9 0L11.3805 5.72348L17.5595 6.21885L12.8518 10.2515L14.2901 16.2812L9 13.05L3.70993 16.2812L5.14822 10.2515L0.440492 6.21885L6.61947 5.72348L9 0Z' fill='%23E64E8D'/%3E%3Cpath d='M33 0L35.3805 5.72348L41.5595 6.21885L36.8518 10.2515L38.2901 16.2812L33 13.05L27.7099 16.2812L29.1482 10.2515L24.4405 6.21885L30.6195 5.72348L33 0Z' fill='%23E64E8D'/%3E%3Cpath d='M57 0L59.3805 5.72348L65.5595 6.21885L60.8518 10.2515L62.2901 16.2812L57 13.05L51.7099 16.2812L53.1482 10.2515L48.4405 6.21885L54.6195 5.72348L57 0Z' fill='%23E64E8D'/%3E%3Cpath d='M81 0L83.3805 5.72348L89.5595 6.21885L84.8518 10.2515L86.2901 16.2812L81 13.05L75.7099 16.2812L77.1482 10.2515L72.4405 6.21885L78.6195 5.72348L81 0Z' fill='%23E64E8D'/%3E%3Cpath d='M105 0L107.381 5.72348L113.56 6.21885L108.852 10.2515L110.29 16.2812L105 13.05L99.7099 16.2812L101.148 10.2515L96.4405 6.21885L102.619 5.72348L105 0Z' fill='%23E64E8D'/%3E%3C/svg%3E%0A");}/*!sc*/
  404. @media (min-width:768px) and (max-width:1000px){.dycFDI{margin-bottom:3px;width:18px;min-width:18px;overflow:hidden;}}/*!sc*/
  405. @media (min-width:480px) and (max-width:768px){.dycFDI{margin-bottom:3px;width:18px;min-width:18px;overflow:hidden;}}/*!sc*/
  406. @media (min-width:361px) and (max-width:480px){.dycFDI{margin-bottom:3px;width:18px;min-width:18px;overflow:hidden;}}/*!sc*/
  407. @media (min-width:1px) and (max-width:361px){.dycFDI{margin-bottom:3px;width:18px;min-width:18px;overflow:hidden;}}/*!sc*/
  408. data-styled.g194[id="rating-stars-style__Stars-sc-a59b5b95-2"]{content:"dycFDI,"}/*!sc*/
  409. .akQqE{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;overflow:hidden;}/*!sc*/
  410. data-styled.g195[id="rating-stars-style__Rating-sc-a59b5b95-3"]{content:"akQqE,"}/*!sc*/
  411. .bGDRtY{position:absolute;width:100%;height:100%;bottom:0;}/*!sc*/
  412. @media (max-width:600px){.bGDRtY{display:none;}}/*!sc*/
  413. data-styled.g197[id="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0"]{content:"bGDRtY,"}/*!sc*/
  414. .ljuySt{margin-bottom:30px;position:relative;width:192px;height:127px;-webkit-align-self:center;-ms-flex-item-align:center;align-self:center;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;cursor:pointer;-webkit-transform:none;-ms-transform:none;transform:none;}/*!sc*/
  415. @media (max-width:1000px){.ljuySt{display:none;}}/*!sc*/
  416. .eNFRBQ{margin-bottom:30px;position:relative;width:192px;height:127px;-webkit-align-self:center;-ms-flex-item-align:center;align-self:center;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;cursor:pointer;-webkit-transform:scale(0.8);-ms-transform:scale(0.8);transform:scale(0.8);}/*!sc*/
  417. @media (max-width:1000px){.eNFRBQ{display:none;}}/*!sc*/
  418. data-styled.g203[id="product-card-style__ProductCardImage-sc-7aa9b87e-0"]{content:"ljuySt,eNFRBQ,"}/*!sc*/
  419. .ZccgF{width:192px;height:127px;display:none;margin:0 auto;}/*!sc*/
  420. @media (max-width:1000px){.ZccgF{display:block;}}/*!sc*/
  421. .ZccgF .swiper-pagination{bottom:15px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;-webkit-align-items:flex-start;-webkit-box-align:flex-start;-ms-flex-align:flex-start;align-items:flex-start;}/*!sc*/
  422. .ZccgF .swiper-pagination .swiper-pagination-bullet{background:#d9dde7;opacity:1;width:5px;height:5px;}/*!sc*/
  423. .ZccgF .swiper-pagination .swiper-pagination-bullet-active{background:#9ca0a9;}/*!sc*/
  424. @media (max-width:480px){.ZccgF .swiper-pagination{bottom:5px;}.ZccgF img{min-width:100px;min-height:100px;}}/*!sc*/
  425. data-styled.g204[id="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1"]{content:"ZccgF,"}/*!sc*/
  426. .iUSxSR{width:192px;height:127px;margin-bottom:30px;position:relative;}/*!sc*/
  427. @media (max-width:480px){.iUSxSR{margin-bottom:17px;}}/*!sc*/
  428. data-styled.g205[id="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2"]{content:"iUSxSR,"}/*!sc*/
  429. .hshmym{width:-webkit-fit-content;width:-moz-fit-content;width:fit-content;font-size:15px;line-height:140%;color:#302E30;word-break:break-word;cursor:pointer;max-height:60px;overflow:hidden;display:-webkit-box;-webkit-line-clamp:2;-webkit-box-orient:vertical;}/*!sc*/
  430. @media (max-width:1000px){.hshmym{margin-top:35px;}}/*!sc*/
  431. @media (max-width:480px){.hshmym{margin-top:30px;}}/*!sc*/
  432. data-styled.g207[id="product-card-style__ProductCardTitle-sc-7aa9b87e-4"]{content:"hshmym,"}/*!sc*/
  433. .hRpIkX{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;margin-top:5px;}/*!sc*/
  434. data-styled.g208[id="product-card-style__ProductCardRating-sc-7aa9b87e-5"]{content:"hRpIkX,"}/*!sc*/
  435. .hPYqn{margin-top:auto;}/*!sc*/
  436. data-styled.g212[id="product-card-style__ProductCardPrice-sc-7aa9b87e-9"]{content:"hPYqn,"}/*!sc*/
  437. .kfCpwQ{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;-webkit-box-pack:justify;-webkit-justify-content:space-between;-ms-flex-pack:justify;justify-content:space-between;margin-top:4px;}/*!sc*/
  438. data-styled.g214[id="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11"]{content:"kfCpwQ,"}/*!sc*/
  439. .hGOFoQ{position:relative;top:-2px;}/*!sc*/
  440. data-styled.g216[id="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13"]{content:"hGOFoQ,"}/*!sc*/
  441. .bUzLdl{font-weight:500;font-size:22px;line-height:26px;color:#302e30;}/*!sc*/
  442. .bUzLdl span{margin-right:11px;}/*!sc*/
  443. data-styled.g217[id="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14"]{content:"bUzLdl,"}/*!sc*/
  444. .gRAkQO{position:absolute;top:20px;left:20px;z-index:2;}/*!sc*/
  445. .gRAkQO .label__Label-sc-5a629cc6-0:not(:first-child){margin-top:6px;}/*!sc*/
  446. @media (max-width:480px){.gRAkQO{top:0;left:0;}}/*!sc*/
  447. data-styled.g220[id="product-card-style__Labels-sc-7aa9b87e-17"]{content:"gRAkQO,"}/*!sc*/
  448. .gOGslI{padding:40px 20px 35px 20px;border-radius:3px;background:white;width:272px;min-height:385px;position:relative;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;}/*!sc*/
  449. .gOGslI:hover{box-shadow:0px 2px 12px rgba(99,47,117,0.09);}/*!sc*/
  450. .gOGslI:hover .product-card-style__ProductCardTitle-sc-7aa9b87e-4{color:#E54E8D;}/*!sc*/
  451. .gOGslI .popover-product-cart-style__CartButton-sc-1766b769-2 button{width:40px !important;}/*!sc*/
  452. @media (max-width:1000px){.gOGslI{padding:40px 20px 35px 20px;}.gOGslI .product-card-style__ProductCardFavorites-sc-7aa9b87e-3{top:20px;right:20px;}}/*!sc*/
  453. @media (max-width:768px){.gOGslI .product-card-style__ProductCardCartButton-sc-7aa9b87e-16 button{width:34px !important;height:34px !important;}}/*!sc*/
  454. @media (max-width:480px){.gOGslI{padding:20px 0 0 0 !important;width:212px;min-height:274px;}.gOGslI:hover{box-shadow:none;}.gOGslI .product-card-style__ProductCardImage-sc-7aa9b87e-0{height:100px;}.gOGslI .product-card-style__ProductCardImage-sc-7aa9b87e-0 img{height:100px !important;width:100px !important;}.gOGslI .product-card-style__ProductCardFavorites-sc-7aa9b87e-3{top:0px;right:0px;width:30px;height:30px;}.gOGslI .product-card-style__ProductCardTitle-sc-7aa9b87e-4{font-size:14px;line-height:19px;max-height:64px;}.gOGslI .product-card-style__ProductCardRating-sc-7aa9b87e-5 .product-card-style__ProductCardRatingStar-sc-7aa9b87e-6 svg{width:15px;height:15px;}.gOGslI .product-card-style__ProductCardRating-sc-7aa9b87e-5 .product-card-style__ProductCardRatingScore-sc-7aa9b87e-7,.gOGslI .product-card-style__ProductCardRating-sc-7aa9b87e-5 .product-card-style__ProductCardRatingValue-sc-7aa9b87e-8{font-size:12px;}.gOGslI .product-card-style__ProductCardPrice-sc-7aa9b87e-9 .product-card-style__ProductCardOldPrice-sc-7aa9b87e-10{display:none;}.gOGslI .product-card-style__ProductCardPrice-sc-7aa9b87e-9 .product-card-style__ProductCardPriceValue-sc-7aa9b87e-14{font-size:18px;line-height:21px;-webkit-flex-direction:column-reverse !important;-ms-flex-direction:column-reverse !important;flex-direction:column-reverse !important;-webkit-align-items:flex-start !important;-webkit-box-align:flex-start !important;-ms-flex-align:flex-start !important;align-items:flex-start !important;}.gOGslI .product-card-style__ProductCardPrice-sc-7aa9b87e-9 .product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 .product-card-style__ProductCardOldPrice-sc-7aa9b87e-10{margin-left:0 !important;}.gOGslI .product-card-style__ProductCardPrice-sc-7aa9b87e-9 .product-card-style__ProductCardPriceFrom-sc-7aa9b87e-15{margin-top:2px;font-size:12px;line-height:15px;}.gOGslI .product-card-style__ProductCardCartButton-sc-7aa9b87e-16 button{width:34px !important;height:34px !important;}}/*!sc*/
  455. data-styled.g221[id="product-card-style__StyledProductCard-sc-7aa9b87e-18"]{content:"gOGslI,"}/*!sc*/
  456. .efnmSP{width:100%;position:absolute;bottom:-13px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;gap:8px;}/*!sc*/
  457. data-styled.g222[id="product-card-style__Bullets-sc-7aa9b87e-19"]{content:"efnmSP,"}/*!sc*/
  458. .cNxRMn{opacity:1;width:5px;height:5px;border-radius:50%;background:#9ca0a9;}/*!sc*/
  459. .eQfAYH{opacity:1;width:5px;height:5px;border-radius:50%;background:#d9dde7;}/*!sc*/
  460. data-styled.g223[id="product-card-style__Bullet-sc-7aa9b87e-20"]{content:"cNxRMn,eQfAYH,"}/*!sc*/
  461. .gbMoUx{margin-top:20px;font-size:15px;line-height:140%;background:#f9f7fa;color:#302e30;width:100%;height:60px;border-radius:3px;cursor:pointer;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;}/*!sc*/
  462. .gbMoUx span{color:#9ca0a9;margin-left:5px;}/*!sc*/
  463. .gbMoUx:hover{background:#fafafa;}/*!sc*/
  464. data-styled.g286[id="show-more-button-style__StyledShowMoreButton-sc-e7dcca96-0"]{content:"gbMoUx,"}/*!sc*/
  465. .leJrty{border-bottom:1px solid #d9dde7;padding-bottom:27px;font-size:15px;line-height:140%;color:#302E30;cursor:pointer;}/*!sc*/
  466. .leJrty:hover{color:#E54E8D;border-color:#E54E8D;}/*!sc*/
  467. data-styled.g288[id="faq-style__FaqItem-sc-d56e7776-0"]{content:"leJrty,"}/*!sc*/
  468. .fJKbOZ{display:grid;grid-template-columns:repeat(2,1fr);grid-row-gap:30px;grid-column-gap:40px;}/*!sc*/
  469. data-styled.g289[id="faq-style__FaqItems-sc-d56e7776-1"]{content:"fJKbOZ,"}/*!sc*/
  470. .kZicxT .show-more-button__ShowMoreButton-sc-a94f7924-0{margin-top:35px;}/*!sc*/
  471. @media (max-width:1000px){.kZicxT{grid-row-gap:20px;grid-column-gap:24px;}.kZicxT .faq-style__FaqItems-sc-d56e7776-1{grid-column-gap:20px;}.kZicxT .faq-style__FaqItem-sc-d56e7776-0{padding-bottom:15px;font-size:15px;line-height:21px;}.kZicxT .block-title__BlockTitle-sc-1541926b-0{margin-bottom:35px;}}/*!sc*/
  472. @media (max-width:480px){.kZicxT .faq-style__FaqItems-sc-d56e7776-1{grid-row-gap:20px;grid-template-columns:1fr;}.kZicxT .block-title__BlockTitle-sc-1541926b-0{margin-bottom:25px;}.kZicxT .show-more-button__ShowMoreButton-sc-a94f7924-0{margin-top:25px;height:40px;}}/*!sc*/
  473. data-styled.g290[id="faq-style__StyledFaq-sc-d56e7776-2"]{content:"kZicxT,"}/*!sc*/
  474. .dAQdzv{margin-top:33px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;row-gap:15px;-webkit-column-gap:15px;column-gap:15px;}/*!sc*/
  475. data-styled.g295[id="tags-block-style__TagsList-sc-465ab32d-0"]{content:"dAQdzv,"}/*!sc*/
  476. .gXUAbK{margin-top:70px;}/*!sc*/
  477. @media (max-width:1000px){.gXUAbK{margin-top:50px;}.gXUAbK .tags-block-style__TagsList-sc-465ab32d-0{margin-top:35px;-webkit-flex-wrap:nowrap;-ms-flex-wrap:nowrap;flex-wrap:nowrap;overflow-x:scroll;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:start;-webkit-justify-content:flex-start;-ms-flex-pack:start;justify-content:flex-start;-webkit-column-gap:8px;column-gap:8px;-ms-overflow-style:none;-webkit-scrollbar-width:none;-moz-scrollbar-width:none;-ms-scrollbar-width:none;scrollbar-width:none;width:calc(100% + 60px);position:relative;left:-30px;padding:0 30px;}.gXUAbK .tags-block-style__TagsList-sc-465ab32d-0::-webkit-scrollbar{width:0;height:0;}.gXUAbK .tags-block-style__TagsList-sc-465ab32d-0 .tag-style__StyledTag-sc-396bf384-1{min-width:-webkit-max-content;min-width:-moz-max-content;min-width:max-content;}}/*!sc*/
  478. @media (max-width:600px){.gXUAbK .tags-block-style__TagsList-sc-465ab32d-0{width:calc(100% + 40px);position:relative;left:-20px;padding:0 20px;}}/*!sc*/
  479. @media (max-width:480px){.gXUAbK{margin-top:35px;}.gXUAbK .tags-block-style__TagsList-sc-465ab32d-0{margin-top:25px;}}/*!sc*/
  480. data-styled.g296[id="tags-block-style__StyledTagsBlock-sc-465ab32d-1"]{content:"gXUAbK,"}/*!sc*/
  481. .cRfzTh{background:#fafafa;border:1px solid #fafafa;border-radius:3px;padding:8px 20px;min-width:-webkit-max-content;min-width:-moz-max-content;min-width:max-content;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;font-size:14px;color:#302E30;}/*!sc*/
  482. .cRfzTh svg{margin-left:7px;}/*!sc*/
  483. .cRfzTh.largeMargin svg{margin-left:10px;}/*!sc*/
  484. .cRfzTh:hover{border:1px solid #E54E8D;}/*!sc*/
  485. data-styled.g297[id="dropdown-button-style__StyledButton-sc-3cc38e98-0"]{content:"cRfzTh,"}/*!sc*/
  486. .klXuck{margin-top:33px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;row-gap:15px;-webkit-column-gap:15px;column-gap:15px;}/*!sc*/
  487. data-styled.g343[id="tags-block-style__TagsList-sc-d18f27a5-0"]{content:"klXuck,"}/*!sc*/
  488. .gKLNbb{margin-top:70px;}/*!sc*/
  489. @media (max-width:1000px){.gKLNbb{margin-top:30px;}.gKLNbb .tags-block-style__TagsList-sc-d18f27a5-0{margin-top:24px;-webkit-flex-wrap:nowrap;-ms-flex-wrap:nowrap;flex-wrap:nowrap;overflow-x:scroll;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:start;-webkit-justify-content:flex-start;-ms-flex-pack:start;justify-content:flex-start;-webkit-column-gap:8px;column-gap:8px;-ms-overflow-style:none;-webkit-scrollbar-width:none;-moz-scrollbar-width:none;-ms-scrollbar-width:none;scrollbar-width:none;width:calc(100% + 60px);position:relative;left:-30px;padding:0 30px;}.gKLNbb .tags-block-style__TagsList-sc-d18f27a5-0::-webkit-scrollbar{width:0;height:0;}.gKLNbb .tags-block-style__TagsList-sc-d18f27a5-0 .tag-style__StyledTag-sc-396bf384-1{min-width:-webkit-max-content;min-width:-moz-max-content;min-width:max-content;}}/*!sc*/
  490. @media (max-width:600px){.gKLNbb .tags-block-style__TagsList-sc-d18f27a5-0{width:calc(100% + 40px);position:relative;left:-20px;padding:0 20px;}}/*!sc*/
  491. @media (max-width:480px){.gKLNbb{margin-top:35px;}.gKLNbb .tags-block-style__TagsList-sc-d18f27a5-0{margin-top:25px;}}/*!sc*/
  492. data-styled.g344[id="tags-block-style__StyledTagsBlock-sc-d18f27a5-1"]{content:"gKLNbb,"}/*!sc*/
  493. .jDilgq{position:absolute;inset:0;margin:auto;background:#E54E8D;opacity:0.94;border-radius:50%;color:white;}/*!sc*/
  494. .jDilgq svg{width:14px;height:14px;position:relative;right:-1px;}/*!sc*/
  495. data-styled.g345[id="video-style__MainVideoPlayButton-sc-d584cd7d-0"]{content:"jDilgq,"}/*!sc*/
  496. .ejISWo{width:100%;overflow:hidden;position:relative;background:black;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;height:261.8px;}/*!sc*/
  497. .ejISWo.isKeyword{max-height:192.63px;}/*!sc*/
  498. .ejISWo span{position:unset !important;}/*!sc*/
  499. .ejISWo .custom-img{object-fit:contain;width:100% !important;position:relative !important;height:unset !important;}/*!sc*/
  500. data-styled.g346[id="video-style__MainVideoImage-sc-d584cd7d-1"]{content:"ejISWo,"}/*!sc*/
  501. .ggeYpB{margin-top:20px;display:-webkit-box;-webkit-line-clamp:2;-webkit-box-orient:vertical;text-overflow:ellipsis;overflow:hidden;font-size:15px;line-height:140%;color:#302E30;}/*!sc*/
  502. data-styled.g347[id="video-style__MainVideoText-sc-d584cd7d-2"]{content:"ggeYpB,"}/*!sc*/
  503. .beSnay{width:100%;cursor:pointer;}/*!sc*/
  504. .beSnay:hover .video-style__MainVideoPlayButton-sc-d584cd7d-0{background:#F25292;}/*!sc*/
  505. .beSnay:hover .video-style__MainVideoText-sc-d584cd7d-2{color:#E54E8D;}/*!sc*/
  506. data-styled.g348[id="video-style__StyledMainVideo-sc-d584cd7d-3"]{content:"beSnay,"}/*!sc*/
  507. .jlANNw{display:grid;grid-template-columns:repeat(24,minmax(0,1fr));-moz-column-gap:40px;-webkit-column-gap:40px;column-gap:40px;position:relative;}/*!sc*/
  508. @media screen and (max-width:992px){.jlANNw{grid-template-columns:1fr;}}/*!sc*/
  509. data-styled.g349[id="grid__Grid-sc-964b01b5-0"]{content:"jlANNw,"}/*!sc*/
  510. .iuWAyz{margin-top:40px;}/*!sc*/
  511. .iuWAyz .grid__Grid-sc-964b01b5-0{grid-row-gap:40px;grid-column-gap:20px;}/*!sc*/
  512. .iuWAyz .video__MainVideo-sc-17215f28-0{grid-column:span 8 / span 8;}/*!sc*/
  513. .iuWAyz .video__MainVideo-sc-17215f28-0:only-child{grid-column:span 24 / span 24;}/*!sc*/
  514. .iuWAyz .video__MainVideo-sc-17215f28-0:only-child .video-style__MainVideoImage-sc-d584cd7d-1{height:400px;}/*!sc*/
  515. .iuWAyz .show-more-button__ShowMoreButton-sc-a94f7924-0{margin-top:40px;}/*!sc*/
  516. @media (max-width:1000px){.iuWAyz .show-more-button__ShowMoreButton-sc-a94f7924-0{margin-top:85px;}}/*!sc*/
  517. @media screen and (max-width:768px){.iuWAyz{margin-top:0;}}/*!sc*/
  518. data-styled.g376[id="videos-style__MainVideosContent-sc-1d67c147-0"]{content:"iuWAyz,"}/*!sc*/
  519. .kItBOm{margin-top:80px;}/*!sc*/
  520. .kItBOm .block-title__BlockTitle-sc-1541926b-0{margin-bottom:40px;}/*!sc*/
  521. @media (max-width:1000px){.kItBOm{margin-top:50px;}.kItBOm .block-title__BlockTitle-sc-1541926b-0{margin-bottom:35px;}.kItBOm .grid__Grid-sc-964b01b5-0{grid-template-columns:1fr 1fr 1fr;row-gap:70px;-webkit-column-gap:24px;column-gap:24px;}.kItBOm .video__MainVideo-sc-17215f28-0,.kItBOm .video__MainVideo-sc-17215f28-0:first-child,.kItBOm .video__MainVideo-sc-17215f28-0:nth-child(6){grid-column:unset !important;}.kItBOm .video-style__MainVideoText-sc-d584cd7d-2{margin-top:15px;font-size:13px;line-height:18px;max-height:36px;padding-right:5px;text-overflow:ellipsis;overflow:hidden;}}/*!sc*/
  522. @media (max-width:768px){.kItBOm .grid__Grid-sc-964b01b5-0{grid-template-columns:1fr 1fr;grid-row-gap:70px;grid-column-gap:20px;}.kItBOm .videos-style__MainVideosContent-sc-1d67c147-0 .show-more-button-style__StyledShowMoreButton-sc-e7dcca96-0{margin-top:24px;height:42px;}}/*!sc*/
  523. @media (max-width:590px){.kItBOm{margin-top:35px;}.kItBOm .block-title__BlockTitle-sc-1541926b-0{margin-bottom:25px;}.kItBOm .grid__Grid-sc-964b01b5-0{grid-template-columns:1fr 1fr;row-gap:70px;-webkit-column-gap:16px;column-gap:16px;}.kItBOm .video-style__MainVideoText-sc-d584cd7d-2{margin-top:15px;font-size:14px;}}/*!sc*/
  524. @media (max-width:500px){.kItBOm .grid__Grid-sc-964b01b5-0{grid-template-columns:1fr;grid-row-gap:40px;}}/*!sc*/
  525. data-styled.g377[id="videos-style__StyledMainVideos-sc-1d67c147-1"]{content:"kItBOm,"}/*!sc*/
  526. .hXHXCt iframe{aspect-ratio:16 / 9;width:100%;}/*!sc*/
  527. @media (max-width:768px){.hXHXCt iframe{margin-bottom:40px;}}/*!sc*/
  528. data-styled.g378[id="videos-style__MainVideosEmbeded-sc-1d67c147-2"]{content:"hXHXCt,"}/*!sc*/
  529. .cAJvsz{width:100%;background:#302E30;}/*!sc*/
  530. @media screen and (max-width:992px){.cAJvsz{display:none;}}/*!sc*/
  531. data-styled.g382[id="header-style__HeaderTop-sc-4e7756a5-0"]{content:"cAJvsz,"}/*!sc*/
  532. .cKPPGM{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;height:49px;}/*!sc*/
  533. .cKPPGM .location-button-style__LocationButton-sc-68155fee-1{height:33px;}/*!sc*/
  534. data-styled.g383[id="header-style__HeaderTopContent-sc-4e7756a5-1"]{content:"cKPPGM,"}/*!sc*/
  535. .ekBzgO{width:100%;min-height:92px;background:#f9f7fa;overflow:hidden;display:block;}/*!sc*/
  536. .ekBzgO.guide{margin-bottom:60px;min-height:30px;}/*!sc*/
  537. @media (max-width:768px){.ekBzgO{display:block;}}/*!sc*/
  538. data-styled.g384[id="header-style__HeaderBottomGreyZone-sc-4e7756a5-2"]{content:"ekBzgO,"}/*!sc*/
  539. .fTCUdA{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;height:92px;position:relative;}/*!sc*/
  540. @media (max-width:1000px){.fTCUdA{height:96px;}}/*!sc*/
  541. @media (max-width:992px){.fTCUdA{display:block;height:unset;padding-top:20px;padding-bottom:16px;}}/*!sc*/
  542. @media (max-width:480px){.fTCUdA{padding-top:20px;}}/*!sc*/
  543. data-styled.g385[id="header-style__HeaderBottomContent-sc-4e7756a5-3"]{content:"fTCUdA,"}/*!sc*/
  544. .hntPjV{-webkit-flex:1;-ms-flex:1;flex:1;margin-left:20px;margin-right:25px;}/*!sc*/
  545. @media (max-width:992px){.hntPjV{margin-left:0;width:100%;margin-top:20px;}}/*!sc*/
  546. data-styled.g386[id="header-style__SearchBox-sc-4e7756a5-4"]{content:"hntPjV,"}/*!sc*/
  547. .gVvHHv{width:100%;background:white;z-index:5;position:relative;}/*!sc*/
  548. @media (max-width:992px){.gVvHHv{position:fixed;top:0;}}/*!sc*/
  549. .gVvHHv.fixedHeader{position:fixed;top:0;box-shadow:0px 2px 12px rgba(99,47,117,0.14);}/*!sc*/
  550. .gVvHHv.fixedHeader .header-style__HeaderBottomContent-sc-4e7756a5-3{height:90px;}/*!sc*/
  551. @media (max-width:992px){.gVvHHv.fixedHeader .header-style__HeaderBottomContent-sc-4e7756a5-3{height:unset;}.gVvHHv.fixedHeader .header-style__SearchBox-sc-4e7756a5-4{display:none;}}/*!sc*/
  552. @media (max-width:992px){.gVvHHv.fixedHeader .header-style__SearchBox-sc-4e7756a5-4{display:none;}}/*!sc*/
  553. data-styled.g387[id="header-style__HeaderBottom-sc-4e7756a5-5"]{content:"gVvHHv,"}/*!sc*/
  554. .bZfVXr{font-size:14px;line-height:140%;color:#d9dde7;margin-left:auto;}/*!sc*/
  555. .bZfVXr a:not(:first-child){margin-left:46px;}/*!sc*/
  556. .bZfVXr a:hover{color:#ffffff;-webkit-text-decoration:underline;text-decoration:underline;}/*!sc*/
  557. @media screen and (max-width:1200px){.bZfVXr:not(:first-child) a{margin-left:25px;}}/*!sc*/
  558. @media (max-width:1000px){.bZfVXr{font-size:14px;line-height:130%;}}/*!sc*/
  559. data-styled.g388[id="header-style__Links-sc-4e7756a5-6"]{content:"bZfVXr,"}/*!sc*/
  560. .ksWgac{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;}/*!sc*/
  561. data-styled.g389[id="header-style__LogoBlock-sc-4e7756a5-7"]{content:"ksWgac,"}/*!sc*/
  562. .eqhQLm{background:linear-gradient(219.96deg,#6f5ee2 9.42%,#e04c8a 91%);height:42px;width:42px;border-radius:50%;cursor:pointer;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;font-weight:900;font-size:14px;-webkit-letter-spacing:0.05em;-moz-letter-spacing:0.05em;-ms-letter-spacing:0.05em;letter-spacing:0.05em;text-transform:uppercase;color:#ffffff;}/*!sc*/
  563. @media (max-width:992px){.eqhQLm{width:36px;height:36px;font-size:12px;}}/*!sc*/
  564. @media (max-width:480px){.eqhQLm{width:32px;height:32px;font-size:10px;line-height:12px;}}/*!sc*/
  565. data-styled.g390[id="header-style__Logo-sc-4e7756a5-8"]{content:"eqhQLm,"}/*!sc*/
  566. .hglszl{margin-left:9px;cursor:pointer;}/*!sc*/
  567. @media (max-width:992px){.hglszl{margin-left:10px;}}/*!sc*/
  568. @media (max-width:480px){.hglszl{margin-left:7px;}}/*!sc*/
  569. data-styled.g391[id="header-style__LogoMarketNameBlock-sc-4e7756a5-9"]{content:"hglszl,"}/*!sc*/
  570. .bMHAap{font-weight:700;font-size:24px;line-height:120%;color:#302E30;}/*!sc*/
  571. @media (max-width:480px){.bMHAap{line-height:20px;}}/*!sc*/
  572. data-styled.g392[id="header-style__LogoMarketName-sc-4e7756a5-10"]{content:"bMHAap,"}/*!sc*/
  573. .cYWPlb{font-size:13px;line-height:140%;color:#9CA0A9;margin-top:-5px;}/*!sc*/
  574. @media (max-width:992px){.cYWPlb{font-size:11px;}}/*!sc*/
  575. data-styled.g393[id="header-style__LogoMarketSubname-sc-4e7756a5-11"]{content:"cYWPlb,"}/*!sc*/
  576. .eKkwbr{background:#efefef;height:42px;width:1px;margin-left:10px;margin-right:10px;}/*!sc*/
  577. @media (max-width:992px){.eKkwbr{margin:0 13px;height:30px;}}/*!sc*/
  578. @media (max-width:480px){.eKkwbr{margin:0 8px;}}/*!sc*/
  579. data-styled.g394[id="header-style__LogoDivider-sc-4e7756a5-12"]{content:"eKkwbr,"}/*!sc*/
  580. .gdjuxi{font-size:13px;line-height:140%;color:#9CA0A9;max-width:135px;}/*!sc*/
  581. @media (max-width:480px){.gdjuxi{font-size:12px;line-height:15px;}}/*!sc*/
  582. data-styled.g395[id="header-style__LogoMarketDescription-sc-4e7756a5-13"]{content:"gdjuxi,"}/*!sc*/
  583. .iuTbJc{margin-left:30px;}/*!sc*/
  584. @media (max-width:1000px){.iuTbJc{margin-left:20px;}}/*!sc*/
  585. @media (max-width:992px){.iuTbJc{display:none;}}/*!sc*/
  586. data-styled.g396[id="header-style__CatalogueButton-sc-4e7756a5-14"]{content:"iuTbJc,"}/*!sc*/
  587. .bKCmsG{margin-left:20px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;margin-left:auto;}/*!sc*/
  588. @media (max-width:992px){.bKCmsG{display:none;}}/*!sc*/
  589. data-styled.g397[id="header-style__HeaderBottomButtons-sc-4e7756a5-15"]{content:"bKCmsG,"}/*!sc*/
  590. .iXqeVh{margin:0 auto;width:30px;height:30px;position:relative;}/*!sc*/
  591. .iXqeVh.cart{margin:0 12px 0 10px;}/*!sc*/
  592. .iXqeVh svg{width:100%;height:auto;}/*!sc*/
  593. data-styled.g398[id="header-style__HeaderBottomButtonIcon-sc-4e7756a5-16"]{content:"iXqeVh,"}/*!sc*/
  594. .jtwwfr{margin:0 auto;width:30px;height:30px;position:relative;}/*!sc*/
  595. .jtwwfr svg{width:100%;height:auto;}/*!sc*/
  596. data-styled.g399[id="header-style__DisabledHeaderBottomButtonIcon-sc-4e7756a5-17"]{content:"jtwwfr,"}/*!sc*/
  597. .jlSEZZ{font-size:13px;line-height:140%;color:#686A70;margin-top:auto;}/*!sc*/
  598. data-styled.g400[id="header-style__HeaderBottomButtonText-sc-4e7756a5-18"]{content:"jlSEZZ,"}/*!sc*/
  599. .iJsmLC{font-size:13px;line-height:140%;color:#686A70;margin-top:auto;}/*!sc*/
  600. @media (max-width:1000px){.iJsmLC{display:none;}}/*!sc*/
  601. data-styled.g401[id="header-style__DisabledHeaderBottomButtonText-sc-4e7756a5-19"]{content:"iJsmLC,"}/*!sc*/
  602. .dwuUiG{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;cursor:pointer;position:relative;}/*!sc*/
  603. .dwuUiG.cart .popover-style__DropContent-sc-5f84575-0.bottom::after{right:20px;left:unset;margin:0;}/*!sc*/
  604. .dwuUiG.favorites .popover-style__DropContent-sc-5f84575-0.bottom::after{left:0;right:0;margin:0 auto;}/*!sc*/
  605. .dwuUiG:not(:first-child){margin-left:25px;}/*!sc*/
  606. .dwuUiG:nth-child(2) svg{width:31.5px;}/*!sc*/
  607. .dwuUiG:nth-child(3) svg{width:32px;}/*!sc*/
  608. .dwuUiG .header-style__HeaderBottomButtonIcon-sc-4e7756a5-16,.dwuUiG .header-style__DisabledHeaderBottomButtonIcon-sc-4e7756a5-17{color:#9CA0A9;}/*!sc*/
  609. .dwuUiG .header-style__HeaderBottomButtonIcon-sc-4e7756a5-16 svg path,.dwuUiG .header-style__DisabledHeaderBottomButtonIcon-sc-4e7756a5-17 svg path{fill:#9CA0A9;}/*!sc*/
  610. .dwuUiG .header-style__HeaderBottomButtonText-sc-4e7756a5-18,.dwuUiG .header-style__DisabledHeaderBottomButtonText-sc-4e7756a5-19{color:#9CA0A9;}/*!sc*/
  611. .dwuUiG:hover .header-style__HeaderBottomButtonIcon-sc-4e7756a5-16{color:#9CA0A9;}/*!sc*/
  612. .dwuUiG:hover .header-style__HeaderBottomButtonIcon-sc-4e7756a5-16 svg path{fill:#9CA0A9;}/*!sc*/
  613. .dwuUiG:hover .header-style__HeaderBottomButtonText-sc-4e7756a5-18{color:#9CA0A9;}/*!sc*/
  614. @media (max-width:1000px){.dwuUiG{-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;}.dwuUiG .header-style__HeaderBottomButtonText-sc-4e7756a5-18{display:none;}}/*!sc*/
  615. .bzNOWg{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;cursor:pointer;position:relative;}/*!sc*/
  616. .bzNOWg.cart .popover-style__DropContent-sc-5f84575-0.bottom::after{right:20px;left:unset;margin:0;}/*!sc*/
  617. .bzNOWg.favorites .popover-style__DropContent-sc-5f84575-0.bottom::after{left:0;right:0;margin:0 auto;}/*!sc*/
  618. .bzNOWg:not(:first-child){margin-left:25px;}/*!sc*/
  619. .bzNOWg:nth-child(2) svg{width:31.5px;}/*!sc*/
  620. .bzNOWg:nth-child(3) svg{width:32px;}/*!sc*/
  621. .bzNOWg .header-style__HeaderBottomButtonIcon-sc-4e7756a5-16,.bzNOWg .header-style__DisabledHeaderBottomButtonIcon-sc-4e7756a5-17{color:#302E30;}/*!sc*/
  622. .bzNOWg .header-style__HeaderBottomButtonIcon-sc-4e7756a5-16 svg path,.bzNOWg .header-style__DisabledHeaderBottomButtonIcon-sc-4e7756a5-17 svg path{fill:#302E30;}/*!sc*/
  623. .bzNOWg .header-style__HeaderBottomButtonText-sc-4e7756a5-18,.bzNOWg .header-style__DisabledHeaderBottomButtonText-sc-4e7756a5-19{color:#686A70;}/*!sc*/
  624. .bzNOWg:hover .header-style__HeaderBottomButtonIcon-sc-4e7756a5-16{color:#E54E8D;}/*!sc*/
  625. .bzNOWg:hover .header-style__HeaderBottomButtonIcon-sc-4e7756a5-16 svg path{fill:#E54E8D;}/*!sc*/
  626. .bzNOWg:hover .header-style__HeaderBottomButtonText-sc-4e7756a5-18{color:#E54E8D;}/*!sc*/
  627. @media (max-width:1000px){.bzNOWg{-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;}.bzNOWg .header-style__HeaderBottomButtonText-sc-4e7756a5-18{display:none;}}/*!sc*/
  628. data-styled.g403[id="header-style__HeaderBottomButton-sc-4e7756a5-21"]{content:"dwuUiG,bzNOWg,"}/*!sc*/
  629. .myjEg{position:fixed;width:24px;height:24px;display:none;right:30px;top:24px;z-index:7;}/*!sc*/
  630. .myjEg div{position:absolute;width:20px;height:2px;border-radius:1px;background:#302E30;border-radius:1px;top:4px;left:2px;-webkit-transition:0.25s;transition:0.25s;}/*!sc*/
  631. .myjEg div:nth-child(2){width:15px;top:11px;left:unset;right:2px;}/*!sc*/
  632. .myjEg div:nth-child(3){top:18px;}/*!sc*/
  633. .myjEg.active div{border-radius:0;}/*!sc*/
  634. .myjEg.active div:nth-child(1){top:6px;-webkit-transform:rotate(45deg);-ms-transform:rotate(45deg);transform:rotate(45deg);}/*!sc*/
  635. .myjEg.active div:nth-child(2){top:6px;-webkit-transform:rotate(-45deg);-ms-transform:rotate(-45deg);transform:rotate(-45deg);width:20px;margin-top:0;}/*!sc*/
  636. .myjEg.active div:nth-child(3){opacity:0;top:6px;-webkit-transform:rotate(45deg);-ms-transform:rotate(45deg);transform:rotate(45deg);}/*!sc*/
  637. @media (max-width:992px){.myjEg{display:block;}}/*!sc*/
  638. @media (max-width:600px){.myjEg{right:20px;}}/*!sc*/
  639. data-styled.g404[id="header-style__MenuBurger-sc-4e7756a5-22"]{content:"myjEg,"}/*!sc*/
  640. .fAFxbC{position:relative;z-index:5;}/*!sc*/
  641. @media (max-width:992px){.fAFxbC .search-results-style__StyledSearchResults-sc-d1322009-0{top:134px;left:0;position:fixed;}.fAFxbC.productPage .header-style__MenuBurger-sc-4e7756a5-22,.fAFxbC.productPage .header-style__HeaderBottom-sc-4e7756a5-5{position:absolute;}}/*!sc*/
  642. @media (max-width:767px){.fAFxbC.productPage .header-style__MenuBurger-sc-4e7756a5-22,.fAFxbC.productPage .header-style__HeaderBottom-sc-4e7756a5-5{position:fixed;}}/*!sc*/
  643. data-styled.g405[id="header-style__StyledHeader-sc-4e7756a5-23"]{content:"fAFxbC,"}/*!sc*/
  644. .hfCLxk{width:100%;min-height:239px;background:white;position:absolute;z-index:3;box-shadow:0px 2px 16px rgba(49,18,59,0.1);border-top:1px solid #ecebed;display:none;}/*!sc*/
  645. @media (max-width:992px){.hfCLxk{display:none;}}/*!sc*/
  646. .hfCLxk.fixedHeader{position:fixed;top:90px;}/*!sc*/
  647. data-styled.g406[id="categories-menu-style__StyledCategoriesMenu-sc-436e8be3-0"]{content:"hfCLxk,"}/*!sc*/
  648. .ciDiHu{max-width:1075px;margin-inline:auto;display:grid;grid-template-columns:repeat(auto-fill,minmax(280px,1fr));grid-row-gap:15px;padding-top:10px;padding-bottom:20px;margin-top:10px;margin-bottom:20px;grid-column-gap:40px;-webkit-box-pack:center;-webkit-justify-content:center;-ms-flex-pack:center;justify-content:center;max-height:420px;overflow:auto;}/*!sc*/
  649. .ciDiHu .popular-category__PopularCategory-sc-4802741c-0{width:100%;}/*!sc*/
  650. .ciDiHu.products{max-width:1210px;grid-template-columns:repeat(auto-fill,minmax(577px,1fr));grid-row-gap:10px;grid-column-gap:40px;padding-right:10px;margin-inline:auto;}/*!sc*/
  651. @media (max-width:650px){.ciDiHu.products{grid-template-columns:1fr;}}/*!sc*/
  652. .ciDiHu::-webkit-scrollbar{width:3px;}/*!sc*/
  653. .ciDiHu::-webkit-scrollbar-track{background:#f9f7fa;border-radius:3px;}/*!sc*/
  654. .ciDiHu::-webkit-scrollbar-thumb{background:#9ca0a9;border-radius:3px;}/*!sc*/
  655. data-styled.g407[id="categories-menu-style__CategoriesMenuContent-sc-436e8be3-1"]{content:"ciDiHu,"}/*!sc*/
  656. .ccrltL .block-title__BlockTitle-sc-1541926b-0{margin-top:80px;margin-bottom:40px;}/*!sc*/
  657. @media (max-width:1000px){.ccrltL{padding-bottom:24px;overflow-x:scroll;-webkit-scrollbar-width:thin;-moz-scrollbar-width:thin;-ms-scrollbar-width:thin;scrollbar-width:thin;-webkit-scrollbar-color:#D9DDE7;-moz-scrollbar-color:#D9DDE7;-ms-scrollbar-color:#D9DDE7;scrollbar-color:#D9DDE7;width:calc(100% + 60px);position:relative;left:-30px;padding:0 30px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;gap:20px;}.ccrltL::-webkit-scrollbar{width:3px;height:3px;}.ccrltL::-webkit-scrollbar-track{background:none;}.ccrltL::-webkit-scrollbar-thumb{border-radius:5px;background:#D9DDE7;width:100px;}.ccrltL::-webkit-scrollbar-thumb{border-left:30px white solid;border-right:30px white solid;}}/*!sc*/
  658. @media (max-width:600px){.ccrltL{width:calc(100% + 40px);position:relative;left:-20px;padding:0 20px;padding:0 20px 20px 20px;}.ccrltL::-webkit-scrollbar-thumb{border-left:20px white solid;border-right:20px white solid;}}/*!sc*/
  659. @media (max-width:550px){.ccrltL{gap:16px;}}/*!sc*/
  660. @media (max-width:882px){.ccrltL .product-card-style__StyledProductCard-sc-7aa9b87e-18{min-width:36%;}}/*!sc*/
  661. @media (max-width:744px){.ccrltL .product-card-style__StyledProductCard-sc-7aa9b87e-18{min-width:37%;}}/*!sc*/
  662. @media (max-width:680px){.ccrltL .product-card-style__StyledProductCard-sc-7aa9b87e-18{min-width:42%;}}/*!sc*/
  663. @media (max-width:512px){.ccrltL .product-card-style__StyledProductCard-sc-7aa9b87e-18{min-width:52%;}}/*!sc*/
  664. @media (max-width:418px){.ccrltL .product-card-style__StyledProductCard-sc-7aa9b87e-18{min-width:65%;}}/*!sc*/
  665. data-styled.g552[id="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0"]{content:"ccrltL,"}/*!sc*/
  666. .XQcPa{background:#ffffff;box-shadow:0px 2px 12px rgba(99,47,117,0.14);border-radius:50%;position:absolute;top:0;bottom:0;left:-7px;margin:auto;z-index:2;}/*!sc*/
  667. .XQcPa:disabled{display:none;}/*!sc*/
  668. .XQcPa:hover:not(:disabled) div{color:#E54E8D;}/*!sc*/
  669. data-styled.g554[id="product-cards-slider-style__PrevProduct-sc-288a6fd3-2"]{content:"XQcPa,"}/*!sc*/
  670. .FnzxQ{background:#ffffff;box-shadow:0px 2px 12px rgba(99,47,117,0.14);border-radius:50%;position:absolute;top:0;bottom:0;right:-18px;margin:auto;z-index:2;}/*!sc*/
  671. .FnzxQ:disabled{display:none;}/*!sc*/
  672. .FnzxQ:hover:not(:disabled) div{color:#E54E8D;}/*!sc*/
  673. data-styled.g555[id="product-cards-slider-style__NextProduct-sc-288a6fd3-3"]{content:"FnzxQ,"}/*!sc*/
  674. .gnmxLE{position:relative;margin:-13px 0 -13px -13px;}/*!sc*/
  675. .gnmxLE .swiper:not(.swiper-initialized) .swiper-wrapper{width:100%;display:grid;grid-template-columns:repeat(4,1fr);gap:20px;max-height:385px;overflow:hidden;}/*!sc*/
  676. @media (max-width:1440px){.gnmxLE .product-cards-slider-style__PrevProduct-sc-288a6fd3-2{left:9px;}.gnmxLE .product-cards-slider-style__NextProduct-sc-288a6fd3-3{right:-6px;}}/*!sc*/
  677. @media (max-width:1457px){.gnmxLE .swiper:not(.swiper-initialized) .swiper-wrapper{grid-template-columns:repeat(5,1fr);gap:20px;}}/*!sc*/
  678. @media (max-width:1281px){.gnmxLE .swiper:not(.swiper-initialized) .swiper-wrapper{grid-template-columns:repeat(4,1fr);gap:20px;}}/*!sc*/
  679. @media (min-width:1001px){.gnmxLE .product-card-style__StyledProductCard-sc-7aa9b87e-18{width:auto;}.gnmxLE .swiper{padding:13px;width:calc(100% + 13px);}}/*!sc*/
  680. data-styled.g556[id="product-cards-slider-style__Slider-sc-288a6fd3-4"]{content:"gnmxLE,"}/*!sc*/
  681. .gmVlav{margin-top:40px;display:grid;grid-template-columns:repeat(4,1fr);grid-row-gap:20px;grid-column-gap:20px;}/*!sc*/
  682. data-styled.g754[id="popular-categories-style__PopularCategoriesContent-sc-6793409d-0"]{content:"gmVlav,"}/*!sc*/
  683. @media (max-width:1050px){.hkxoVe{overflow-x:scroll;-ms-overflow-style:none;-webkit-scrollbar-width:none;-moz-scrollbar-width:none;-ms-scrollbar-width:none;scrollbar-width:none;width:calc(100% + 60px);position:relative;left:-30px;}.hkxoVe::-webkit-scrollbar{width:0;height:0;}}/*!sc*/
  684. @media (max-width:600px){.hkxoVe{width:calc(100% + 40px);position:relative;left:-20px;}.hkxoVe::-webkit-scrollbar-thumb{border-left:20px white solid;border-right:20px white solid;}}/*!sc*/
  685. @media (max-width:480px){.hkxoVe{-ms-overflow-style:none;-webkit-scrollbar-width:none;-moz-scrollbar-width:none;-ms-scrollbar-width:none;scrollbar-width:none;}.hkxoVe::-webkit-scrollbar{width:0;height:0;}}/*!sc*/
  686. data-styled.g755[id="popular-categories-style__PopularCategoriesContentWrapper-sc-6793409d-1"]{content:"hkxoVe,"}/*!sc*/
  687. .jsdiPl{display:none;}/*!sc*/
  688. .jsdiPl button{height:40px;width:100%;font-weight:400;text-transform:none;font-size:14px;color:#302E30 !important;background-color:#f9f7fa !important;-webkit-letter-spacing:unset;-moz-letter-spacing:unset;-ms-letter-spacing:unset;letter-spacing:unset;}/*!sc*/
  689. @media (max-width:480px){.jsdiPl{display:block;}}/*!sc*/
  690. data-styled.g756[id="popular-categories-style__PopularCategoriesShowMoreButton-sc-6793409d-2"]{content:"jsdiPl,"}/*!sc*/
  691. .enCBJz .block-title-style__TitleResponsiveInfo-sc-2857f62c-0{display:none;}/*!sc*/
  692. @media (max-width:1396px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{grid-template-columns:repeat(3,1fr);}}/*!sc*/
  693. @media (max-width:1050px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{margin-top:24px;padding-bottom:22px;padding-left:30px;padding-right:30px;gap:20px;max-height:calc(182px * 2 + 20px + 25px);display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;width:calc((36vw + 30px) * 6);}.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0 .popular-categories-style__NextCategory-sc-6793409d-5,.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0 .popular-categories-style__PrevCategory-sc-6793409d-4{display:none;}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:36vw;height:180px;}}/*!sc*/
  694. @media (max-width:1000px){.enCBJz .block-title-style__TitleResponsiveInfo-sc-2857f62c-0{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;padding-bottom:4px;}.enCBJz .block-title-style__TitleResponsiveInfo-sc-2857f62c-0 a{font-size:13px;}}/*!sc*/
  695. @media (max-width:961px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{width:calc((38vw + 30px) * 6);}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:38vw;}}/*!sc*/
  696. @media (max-width:823px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{width:calc((42vw + 30px) * 6);}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:42vw;}}/*!sc*/
  697. @media (max-width:769px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{width:calc((49vw + 30px) * 6);}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:49vw;}}/*!sc*/
  698. @media (max-width:631px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{width:calc((54vw + 30px) * 6);}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:54vw;}}/*!sc*/
  699. @media (max-width:573px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{width:calc((60vw + 30px) * 6);}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:60vw;}}/*!sc*/
  700. @media (max-width:513px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{width:calc((67vw + 30px) * 6);}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:67vw;}}/*!sc*/
  701. @media (max-width:1000px){.enCBJz{margin-top:0;}}/*!sc*/
  702. @media (max-width:600px){.enCBJz{margin-top:0;}.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{padding:0 20px 25px 20px;}}/*!sc*/
  703. @media (max-width:480px){.enCBJz .block-title__BlockTitle-sc-1541926b-0{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:row;-ms-flex-direction:row;flex-direction:row;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;-webkit-box-pack:justify;-webkit-justify-content:space-between;-ms-flex-pack:justify;justify-content:space-between;}.enCBJz .block-title-style__TitleResponsiveInfo-sc-2857f62c-0{padding-bottom:2px;}.enCBJz .block-title-style__TitleResponsiveInfo-sc-2857f62c-0 a{-webkit-text-decoration:none;text-decoration:none;}.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{margin:25px 0;padding-left:20px;padding-right:20px;padding-bottom:0;-webkit-column-gap:10px;column-gap:10px;row-gap:20px;max-height:calc(151px * 2 + 16px + 20px);width:calc((162px + 16px) * 6);}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:160px;}}/*!sc*/
  704. @media (max-width:380px){.enCBJz .popular-categories-style__PopularCategoriesContent-sc-6793409d-0{width:calc((142px + 16px) * 6);}.enCBJz .popular-category__PopularCategory-sc-4802741c-0,.enCBJz .popular-category-style__StyledPopularCategory-sc-bf41b6b-4{width:140px;}}/*!sc*/
  705. data-styled.g764[id="popular-categories-style__StyledPopularCategories-sc-6793409d-10"]{content:"enCBJz,"}/*!sc*/
  706. .hAWuOw{width:262px;}/*!sc*/
  707. @media (max-width:480px){.hAWuOw{-webkit-flex-direction:row;-ms-flex-direction:row;flex-direction:row;margin-bottom:4px !important;-webkit-align-items:flex-end !important;-webkit-box-align:flex-end !important;-ms-flex-align:flex-end !important;align-items:flex-end !important;}.hAWuOw h2{-webkit-flex:1;-ms-flex:1;flex:1;}}/*!sc*/
  708. data-styled.g767[id="product-category-style__ProductCategoryLeft-sc-770aa322-0"]{content:"hAWuOw,"}/*!sc*/
  709. .jfpAXR{position:relative;top:-30px;width:1148px;margin-left:auto;}/*!sc*/
  710. .jfpAXR .swiper-wrapper{padding:10px;}/*!sc*/
  711. @media (max-width:1440px){.jfpAXR{top:0;width:calc(100% + 44px);position:relative;left:-30px;padding-left:10px;}.jfpAXR .swiper-wrapper{padding:0;}}/*!sc*/
  712. @media (max-width:1000px){.jfpAXR{width:calc(100% + 60px);position:relative;left:-30px;}}/*!sc*/
  713. @media (max-width:647px){.jfpAXR .product-card__ProductCard-sc-6de13d9f-0{width:272px;}.jfpAXR .product-card__ProductCard-sc-6de13d9f-0 .product-card-style__ProductCardImage-sc-7aa9b87e-0{width:232px;}.jfpAXR .product-card__ProductCard-sc-6de13d9f-0:hover{box-shadow:none;}}/*!sc*/
  714. @media (max-width:600px){.jfpAXR{width:calc(100% + 40px);position:relative;left:-20px;}}/*!sc*/
  715. @media (max-width:480px){.jfpAXR .responsive-product-cards-styles__ResponsiveProductCardsWrapper-sc-a5d3d239-1{padding-bottom:0;}.jfpAXR .product-card__ProductCard-sc-6de13d9f-0{min-width:212px;}}/*!sc*/
  716. data-styled.g768[id="product-category-style__ProductCategoryRight-sc-770aa322-1"]{content:"jfpAXR,"}/*!sc*/
  717. .bmtxUH{margin-top:25px;display:none;}/*!sc*/
  718. .bmtxUH button{text-transform:none;font-weight:400;-webkit-letter-spacing:unset;-moz-letter-spacing:unset;-ms-letter-spacing:unset;letter-spacing:unset;background-color:#f9f7fa !important;font-size:14px;line-height:16px;color:#302E30 !important;}/*!sc*/
  719. @media (max-width:480px){.bmtxUH{display:block;}}/*!sc*/
  720. data-styled.g769[id="product-category-style__ProductCategoryShowAll-sc-770aa322-2"]{content:"bmtxUH,"}/*!sc*/
  721. .iBbhNC{min-width:-webkit-max-content;min-width:-moz-max-content;min-width:max-content;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;}/*!sc*/
  722. @media (max-width:1440px){.iBbhNC{-webkit-flex-direction:row;-ms-flex-direction:row;flex-direction:row;}}/*!sc*/
  723. data-styled.g770[id="product-category-style__ProductCategoryInfo-sc-770aa322-3"]{content:"iBbhNC,"}/*!sc*/
  724. .izYtQR{margin-bottom:10px;font-weight:500;font-size:30px;line-height:120%;color:#302E30;word-break:break-word;}/*!sc*/
  725. @media (max-width:1440px){.izYtQR{margin-bottom:0;}}/*!sc*/
  726. @media (max-width:480px){.izYtQR{font-size:20px;line-height:24px;}}/*!sc*/
  727. data-styled.g771[id="product-category-style__ProductCategoryTitle-sc-770aa322-4"]{content:"izYtQR,"}/*!sc*/
  728. .kXuzSN{font-size:13px;line-height:140%;color:#9CA0A9;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;}/*!sc*/
  729. @media (max-width:1000px){.kXuzSN{line-height:unset;}}/*!sc*/
  730. @media (max-width:480px){.kXuzSN{margin-right:0 !important;color:#E54E8D;}}/*!sc*/
  731. data-styled.g772[id="product-category-style__ProductCategoryCount-sc-770aa322-5"]{content:"kXuzSN,"}/*!sc*/
  732. .fa-DHiG{font-size:13px;line-height:140%;-webkit-text-decoration-line:underline;text-decoration-line:underline;color:#E54E8D;margin-top:8px;}/*!sc*/
  733. .fa-DHiG a{color:#E54E8D;}/*!sc*/
  734. .fa-DHiG:hover{-webkit-text-decoration:none;text-decoration:none;}/*!sc*/
  735. @media (max-width:1000px){.fa-DHiG{line-height:unset;position:relative;top:-1px;}}/*!sc*/
  736. @media (max-width:480px){.fa-DHiG{display:none;}}/*!sc*/
  737. data-styled.g773[id="product-category-style__ProductCategoryShowMore-sc-770aa322-6"]{content:"fa-DHiG,"}/*!sc*/
  738. .bySyWs{margin-top:80px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;}/*!sc*/
  739. .bySyWs.largeCards{-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;}/*!sc*/
  740. .bySyWs.largeCards .product-category-style__ProductCategoryRight-sc-770aa322-1{position:unset;width:100%;}/*!sc*/
  741. .bySyWs.largeCards .product-category-style__ProductCategoryLeft-sc-770aa322-0{margin-bottom:30px;width:100%;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-align-items:center;-webkit-box-align:center;-ms-flex-align:center;align-items:center;}/*!sc*/
  742. .bySyWs.largeCards .product-category-style__ProductCategoryShowMore-sc-770aa322-6{display:none;}/*!sc*/
  743. .bySyWs.largeCards .product-category-style__ProductCategoryCount-sc-770aa322-5{margin-left:16px;}/*!sc*/
  744. @media (max-width:1440px){.bySyWs{-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;margin-top:30px;}.bySyWs .product-category-style__ProductCategoryCount-sc-770aa322-5{margin-right:16px;}}/*!sc*/
  745. @media (max-width:480px){.bySyWs{margin-top:24px;margin-bottom:35px;}.bySyWs:last-child{margin-bottom:0;}}/*!sc*/
  746. data-styled.g774[id="product-category-style__StyledProductCategory-sc-770aa322-7"]{content:"bySyWs,"}/*!sc*/
  747. .kNgBAp{margin-top:80px;padding-bottom:40px;}/*!sc*/
  748. .kNgBAp .block-title__BlockTitle-sc-1541926b-0{margin-bottom:40px;}/*!sc*/
  749. .kNgBAp.smallerMarginTop{margin-top:40px;}/*!sc*/
  750. .kNgBAp.noMarginTop,.kNgBAp .product-category-style__StyledProductCategory-sc-770aa322-7{margin-top:0;}/*!sc*/
  751. .kNgBAp .product-category-style__ProductCategoryShowMore-sc-770aa322-6{color:#825bd3;}/*!sc*/
  752. @media (max-width:1440px){.kNgBAp{padding-bottom:30px;}.kNgBAp .product-category-style__ProductCategoryTitle-sc-770aa322-4{font-size:24px;line-height:28px;}.kNgBAp .product-category-style__ProductCategoryCount-sc-770aa322-5{margin-right:20px;}.kNgBAp .product-category-style__StyledProductCategory-sc-770aa322-7{margin-top:30px;-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;}.kNgBAp .product-category-style__StyledProductCategory-sc-770aa322-7 .product-category-style__ProductCategoryLeft-sc-770aa322-0{margin-bottom:24px;width:100%;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;-webkit-box-pack:justify;-webkit-justify-content:space-between;-ms-flex-pack:justify;justify-content:space-between;-webkit-align-items:flex-end;-webkit-box-align:flex-end;-ms-flex-align:flex-end;align-items:flex-end;}.kNgBAp.noMarginTop,.kNgBAp .product-category-style__StyledProductCategory-sc-770aa322-7{margin-top:0 !important;}}/*!sc*/
  753. @media (max-width:1050px){.kNgBAp{margin-top:28px;}.kNgBAp.noMarginTop{margin-top:0;}.kNgBAp .product-category-style__StyledProductCategory-sc-770aa322-7 .product-category-style__ProductCategoryLeft-sc-770aa322-0{-webkit-box-pack:start;-webkit-justify-content:flex-start;-ms-flex-pack:start;justify-content:flex-start;}.kNgBAp .product-category-style__StyledProductCategory-sc-770aa322-7 .product-category-style__ProductCategoryLeft-sc-770aa322-0 .product-category-style__ProductCategoryCount-sc-770aa322-5{margin-left:15px;}}/*!sc*/
  754. @media (max-width:660px){.kNgBAp .product-category-style__ProductCategoryCount-sc-770aa322-5{margin-right:10px;}.kNgBAp .product-category-style__ProductCategoryTitle-sc-770aa322-4{line-height:24px;}}/*!sc*/
  755. @media (max-width:480px){.kNgBAp .product-category-style__ProductCategoryTitle-sc-770aa322-4{font-size:20px;}.kNgBAp .product-category-style__StyledProductCategory-sc-770aa322-7{margin-top:35px;}.kNgBAp.noMarginTop,.kNgBAp.noMarginTop .product-category-style__StyledProductCategory-sc-770aa322-7{margin-top:0;}}/*!sc*/
  756. @media (max-width:350px){.kNgBAp .product-category-style__ProductCategoryTitle-sc-770aa322-4{max-width:70%;}}/*!sc*/
  757. data-styled.g775[id="product-categories-styles__StyledProductCategories-sc-faa38e69-0"]{content:"kNgBAp,"}/*!sc*/
  758. .pFOmo{background:#ffffff;border:1px solid #f6f5f7;box-sizing:border-box;border-radius:3px;padding:20px;-webkit-flex-basis:270px;-ms-flex-preferred-size:270px;flex-basis:270px;min-width:270px;}/*!sc*/
  759. .pFOmo:hover{box-shadow:0px 2px 12px rgba(99,47,117,0.14);}/*!sc*/
  760. @media (max-width:480px){.pFOmo{-webkit-flex-basis:212px;-ms-flex-preferred-size:212px;flex-basis:212px;min-width:212px;}.pFOmo .tag-style__StyledTag-sc-396bf384-1{max-width:182px;}}/*!sc*/
  761. data-styled.g805[id="our-project-style__StyledOurProject-sc-e545f5a6-0"]{content:"pFOmo,"}/*!sc*/
  762. .glfcza a{font-size:17px;line-height:120%;-webkit-text-decoration-line:underline;text-decoration-line:underline;color:#3a373b;}/*!sc*/
  763. .glfcza a:hover{-webkit-text-decoration:none;text-decoration:none;}/*!sc*/
  764. data-styled.g806[id="our-project-style__OurProjectLink-sc-e545f5a6-1"]{content:"glfcza,"}/*!sc*/
  765. .ldtvaL{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;gap:6px;-webkit-flex-wrap:wrap;-ms-flex-wrap:wrap;flex-wrap:wrap;margin-top:20px;}/*!sc*/
  766. .ldtvaL .tag-style__StyledTag-sc-396bf384-1{overflow:hidden;}/*!sc*/
  767. data-styled.g807[id="our-project-style__OurProjectTags-sc-e545f5a6-2"]{content:"ldtvaL,"}/*!sc*/
  768. .dKmVfa{display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;}/*!sc*/
  769. data-styled.g808[id="our-projects-style__OurProjectsContent-sc-fac1caf9-0"]{content:"dKmVfa,"}/*!sc*/
  770. .ckpDlx{width:1148px;display:-webkit-box;display:-webkit-flex;display:-ms-flexbox;display:flex;grid-template-columns:repeat(4,1fr);grid-column-gap:20px;margin-left:auto;}/*!sc*/
  771. data-styled.g810[id="our-projects-style__OurPorjectItems-sc-fac1caf9-2"]{content:"ckpDlx,"}/*!sc*/
  772. .ibDZgc{padding:70px 0;width:100%;background:#f6f5f7;}/*!sc*/
  773. @media (max-width:1290px){.ibDZgc{padding-top:45px;padding-bottom:55px;}.ibDZgc .our-projects-style__OurProjectsContent-sc-fac1caf9-0{-webkit-flex-direction:column;-ms-flex-direction:column;flex-direction:column;}.ibDZgc .our-projects-style__OurProjectsTitle-sc-fac1caf9-1{margin-bottom:24px;}.ibDZgc .our-projects-style__OurPorjectItems-sc-fac1caf9-2{margin-left:0;padding-bottom:0;grid-template-columns:repeat(4,270px);width:calc(100% + 60px);padding-left:30px;padding-right:30px;position:relative;left:-30px;overflow-x:auto;-ms-overflow-style:none;-webkit-scrollbar-width:none;-moz-scrollbar-width:none;-ms-scrollbar-width:none;scrollbar-width:none;}.ibDZgc .our-projects-style__OurPorjectItems-sc-fac1caf9-2::-webkit-scrollbar{width:0;height:0;}}/*!sc*/
  774. @media (max-width:600px){.ibDZgc{width:100%;padding-left:0;padding-right:0;left:0;}.ibDZgc .our-projects-style__OurPorjectItems-sc-fac1caf9-2{width:calc(100% + 40px);left:-20px;padding-left:20px;padding-right:20px;}}/*!sc*/
  775. @media (max-width:480px){.ibDZgc{padding:35px 0;}.ibDZgc .our-projects-style__OurProjectsTitle-sc-fac1caf9-1{margin-bottom:25px;}.ibDZgc .our-projects-style__OurProjectsTitle-sc-fac1caf9-1 div{font-size:20px;}.ibDZgc .our-projects-style__OurPorjectItems-sc-fac1caf9-2{padding-bottom:0;grid-template-columns:repeat(4,212px);grid-column-gap:16px;-ms-overflow-style:none;-webkit-scrollbar-width:none;-moz-scrollbar-width:none;-ms-scrollbar-width:none;scrollbar-width:none;}.ibDZgc .our-projects-style__OurPorjectItems-sc-fac1caf9-2::-webkit-scrollbar{width:0;height:0;}.ibDZgc .our-project-style__StyledOurProject-sc-e545f5a6-0{padding:15px 15px 20px 15px;}.ibDZgc .our-project-style__StyledOurProject-sc-e545f5a6-0 .our-project-style__OurProjectLink-sc-e545f5a6-1 a{font-size:14px;font-weight:500;line-height:16.8px;}.ibDZgc .our-project-style__StyledOurProject-sc-e545f5a6-0 .our-project-style__OurProjectTags-sc-e545f5a6-2{margin-top:16px;}}/*!sc*/
  776. data-styled.g811[id="our-projects-style__StyledOurProjects-sc-fac1caf9-3"]{content:"ibDZgc,"}/*!sc*/
  777. </style></head><body><div id="__next"><script async="" src="https://www.googletagmanager.com/gtag/js?id=G-274M2LXSP8"></script><script id="google_tag_manager">
  778.              window.dataLayer = window.dataLayer || [];
  779.              function gtag(){dataLayer.push(arguments);}
  780.              gtag('js', new Date());
  781.              gtag('config', 'G-274M2LXSP8', { page_path: window.location.pathname });
  782.            </script><script id="yandex_metrics">
  783.                 (function(m,e,t,r,i,k,a){m[i]=m[i]||function(){(m[i].a=m[i].a||[]).push(arguments)};
  784.                 m[i].l=1*new Date();k=e.createElement(t),a=e.getElementsByTagName(t)[0],k.async=1,k.src=r,a.parentNode.insertBefore(k,a)})
  785.                 (window, document, "script", "https://mc.yandex.ru/metrika/tag.js", "ym");
  786.              
  787.                 ym(95767516, "init", {
  788.                      clickmap:true,
  789.                      trackLinks:true,
  790.                      accurateTrackBounce:true,
  791.                      webvisor:true,
  792.                      ecommerce:"dataLayer"
  793.                 });
  794.            </script><script id="mail_top">
  795.                  var _tmr = window._tmr || (window._tmr = []);
  796.                  _tmr.push({id: "3269044", type: "pageView", start: (new Date()).getTime()});
  797.                  (function (d, w, id) {
  798.                    if (d.getElementById(id)) return;
  799.                    var ts = d.createElement("script"); ts.type = "text/javascript"; ts.async = true; ts.id = id;
  800.                    ts.src = "https://top-fwz1.mail.ru/js/code.js";
  801.                    var f = function () {var s = d.getElementsByTagName("script")[0]; s.parentNode.insertBefore(ts, s);};
  802.                    if (w.opera == "[object Opera]") { d.addEventListener("DOMContentLoaded", f, false); } else { f(); }
  803.                  })(document, window, "topmailru-code");
  804.            </script><section data-no-hydrate="true"></section><noscript><div><img src="https://mc.yandex.ru/watch/91454819" style="position:absolute;left:-9999px;" alt=""/></div><div><img src="https://top-fwz1.mail.ru/counter?id=3269044;js=na" style="border:0;position:absolute;left:-9999px" alt="Top.Mail.Ru"/></div></noscript><main class="relative h-screen flex flex-col flex-grow" style="min-height:-webkit-fill-available;-webkit-overflow-scrolling:touch"><div itemscope="" itemType="https://schema.org/WebPage"><section data-no-hydrate="true"><span class="hidden"><span itemProp="name"></span><span itemProp="description"></span></span></section><header class="header-style__StyledHeader-sc-4e7756a5-23 fAFxbC"><div class="header-style__MenuBurger-sc-4e7756a5-22 myjEg"><div></div><div></div><div></div></div><div class="header-style__HeaderTop-sc-4e7756a5-0 cAJvsz"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="header-style__HeaderTopContent-sc-4e7756a5-1 cKPPGM"><div class="location-button-style__LocationButtonContainer-sc-68155fee-0 cXIMUt"><button class="location-button-style__LocationButton-sc-68155fee-1 gCoGvW"><div class="location-button-style__LocationButtonIcon-sc-68155fee-2 hTgthp"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="15" height="15" viewBox="0 0 15 15" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M7.5 14.83L3.5225 10.8525C2.73584 10.0658 2.20012 9.0635 1.98308 7.97236C1.76604 6.88122 1.87744 5.75022 2.30319 4.72239C2.72893 3.69456 3.4499 2.81606 4.37493 2.19798C5.29995 1.5799 6.38749 1.25 7.5 1.25C8.61252 1.25 9.70005 1.5799 10.6251 2.19798C11.5501 2.81606 12.2711 3.69456 12.6968 4.72239C13.1226 5.75022 13.234 6.88122 13.0169 7.97236C12.7999 9.0635 12.2642 10.0658 11.4775 10.8525L7.5 14.83ZM10.5938 9.9687C11.2056 9.35683 11.6222 8.57728 11.791 7.72862C11.9597 6.87997 11.8731 6.00032 11.5419 5.20092C11.2108 4.40152 10.65 3.71827 9.93058 3.23756C9.21112 2.75684 8.36528 2.50027 7.5 2.50027C6.63473 2.50027 5.78888 2.75684 5.06943 3.23756C4.34997 3.71827 3.78922 4.40152 3.45807 5.20092C3.12693 6.00032 3.04026 6.87997 3.20903 7.72862C3.37781 8.57728 3.79444 9.35683 4.40625 9.9687L7.5 13.0625L10.5938 9.9687ZM7.5 8.12495C7.16848 8.12495 6.85054 7.99325 6.61612 7.75883C6.3817 7.52441 6.25 7.20647 6.25 6.87495C6.25 6.54343 6.3817 6.22549 6.61612 5.99107C6.85054 5.75665 7.16848 5.62495 7.5 5.62495C7.83152 5.62495 8.14947 5.75665 8.38389 5.99107C8.61831 6.22549 8.75 6.54343 8.75 6.87495C8.75 7.20647 8.61831 7.52441 8.38389 7.75883C8.14947 7.99325 7.83152 8.12495 7.5 8.12495Z" fill="currentColor"></path></svg></div></div><div class="location-button-style__LocationButtonText-sc-68155fee-3 doQUOZ"><section data-no-hydrate="true">Москва</section></div></button></div><nav class="header-style__Links-sc-4e7756a5-6 bZfVXr"><a href="/about">О сервисе</a><a href="/info/customers">Покупателям</a><a href="/info/delivery">Оплата и доставка</a><a href="/info/garanties">Гарантия и возврат</a><a href="/contacts">Контакты</a></nav></div></div></div><div class="header-style__HeaderBottom-sc-4e7756a5-5 gVvHHv"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="header-style__HeaderBottomContent-sc-4e7756a5-3 fTCUdA"><div class="header-style__LogoBlock-sc-4e7756a5-7 ksWgac"><a href="/" class="header-style__Logo-sc-4e7756a5-8 eqhQLm">do</a><a href="/" class="header-style__LogoMarketNameBlock-sc-4e7756a5-9 hglszl"><div font-size="24" class="header-style__LogoMarketName-sc-4e7756a5-10 bMHAap">DGM</div><div class="header-style__LogoMarketSubname-sc-4e7756a5-11 cYWPlb">online</div></a><div class="header-style__LogoDivider-sc-4e7756a5-12 eKkwbr"></div><div class="header-style__LogoMarketDescription-sc-4e7756a5-13 gdjuxi">специализированный маркетплейс</div></div><div class="header-style__CatalogueButton-sc-4e7756a5-14 iuTbJc"><button class="catalogue-button-style__StyledCatalogueButton-sc-4d1a01b0-2 ka-dLhZ"><div class="catalogue-button-style__ButtonIcon-sc-4d1a01b0-0 jxyjBB"><div></div><div></div><div></div></div><div class="catalogue-button-style__ButtonText-sc-4d1a01b0-1 jPYXNA">Каталог</div></button></div><div class="header-style__SearchBox-sc-4e7756a5-4 hntPjV"><div class="search-style__StyledSearch-sc-d63d0256-0 cpUrDT"><div class="input-search-style__StyledInput-sc-b0882a39-4 ebeqsY"><form><input placeholder="Я ищу ..." class="input-search-style__InputElement-sc-b0882a39-0 eEJVmX input-search__InputSearch-sc-38e72f27-0 eRBDHh" value=""/></form><div class="input-search-style__IconContainers-sc-b0882a39-3 MarsX"><div class="input-search-style__Icon-sc-b0882a39-2 iuKXAR searchIcon"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="22" height="22" viewBox="0 0 22 22" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M9.93945 1.68945C14.4935 1.68945 18.1895 5.38545 18.1895 9.93945C18.1895 14.4935 14.4935 18.1895 9.93945 18.1895C5.38545 18.1895 1.68945 14.4935 1.68945 9.93945C1.68945 5.38545 5.38545 1.68945 9.93945 1.68945ZM9.93945 16.3561C13.4842 16.3561 16.3561 13.4842 16.3561 9.93945C16.3561 6.39379 13.4842 3.52279 9.93945 3.52279C6.39379 3.52279 3.52279 6.39379 3.52279 9.93945C3.52279 13.4842 6.39379 16.3561 9.93945 16.3561ZM17.7174 16.4212L20.3106 19.0135L19.0135 20.3106L16.4212 17.7174L17.7174 16.4212V16.4212Z" fill="currentColor"></path></svg></div></div></div></div></div></div><div class="header-style__HeaderBottomButtons-sc-4e7756a5-15 bKCmsG"><div disabled="" class="header-style__HeaderBottomButton-sc-4e7756a5-21 dwuUiG"><div class="popover-style__StyledPopover-sc-5f84575-1 eeUyMx center POPOVER"><a href="#" class="header-style__HeaderBottomButtonIcon-sc-4e7756a5-16 iXqeVh"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="22" height="22" viewBox="0 0 22 22" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11 2.75L11.3354 2.07918L11 1.91147L10.6646 2.07918L11 2.75ZM19.25 6.875H20V6.41147L19.5854 6.20418L19.25 6.875ZM19.25 15.125L19.5854 15.7958L20 15.5885V15.125H19.25ZM11 19.25L10.6646 19.9208L11 20.0885L11.3354 19.9208L11 19.25ZM2.75 15.125H2V15.5885L2.41459 15.7958L2.75 15.125ZM2.75 6.875L2.41459 6.20418L2 6.41147V6.875H2.75ZM14.8333 11.9167C14.8333 12.3309 15.1691 12.6667 15.5833 12.6667C15.9975 12.6667 16.3333 12.3309 16.3333 11.9167H14.8333ZM15.5833 8.70833H16.3333V8.24481L15.9187 8.03751L15.5833 8.70833ZM7.66874 3.91251C7.29826 3.72727 6.84775 3.87744 6.66251 4.24792C6.47727 4.61841 6.62744 5.06891 6.99792 5.25415L7.66874 3.91251ZM10.25 18.7917C10.25 19.2059 10.5858 19.5417 11 19.5417C11.4142 19.5417 11.75 19.2059 11.75 18.7917H10.25ZM10.6646 3.42082L18.9146 7.54582L19.5854 6.20418L11.3354 2.07918L10.6646 3.42082ZM18.5 6.875V15.125H20V6.875H18.5ZM18.9146 14.4542L10.6646 18.5792L11.3354 19.9208L19.5854 15.7958L18.9146 14.4542ZM11.3354 18.5792L3.08541 14.4542L2.41459 15.7958L10.6646 19.9208L11.3354 18.5792ZM3.5 15.125V6.875H2V15.125H3.5ZM3.08541 7.54582L11.3354 3.42082L10.6646 2.07918L2.41459 6.20418L3.08541 7.54582ZM18.9146 6.20418L10.6646 10.3292L11.3354 11.6708L19.5854 7.54582L18.9146 6.20418ZM11.3354 10.3292L3.08541 6.20418L2.41459 7.54582L10.6646 11.6708L11.3354 10.3292ZM16.3333 11.9167V8.70833H14.8333V11.9167H16.3333ZM15.9187 8.03751L7.66874 3.91251L6.99792 5.25415L15.2479 9.37915L15.9187 8.03751ZM11.75 18.7917V11H10.25V18.7917H11.75Z" fill="currentColor"></path></svg></div><span style="opacity:0;position:absolute">Заказы</span></a><a href="#" class="header-style__HeaderBottomButtonText-sc-4e7756a5-18 jlSEZZ">Заказы</a></div></div><div class="header-style__HeaderBottomButton-sc-4e7756a5-21 dwuUiG favorites" disabled=""><div class="popover-style__StyledPopover-sc-5f84575-1 eeUyMx center POPOVER"><span class="header-style__DisabledHeaderBottomButtonIcon-sc-4e7756a5-17 jtwwfr favorites"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><div class="icon-heart__StyledIconHeart-sc-6dcbbacc-0 cOwaEK"><svg width="30" height="30" viewBox="0 0 30 30" fill="none" xmlns="http://www.w3.org/2000/svg"><path fill-rule="evenodd" clip-rule="evenodd" d="M23.4787 15.7714L14.9988 24.5L6.52098 15.7714C6.49542 15.742 6.47019 15.7124 6.44528 15.6826C6.44224 15.679 6.43921 15.6753 6.43617 15.6717C4.43131 13.2628 4.52565 9.6417 6.71826 7.3461C6.73109 7.33267 6.744 7.31928 6.75697 7.30593C6.77531 7.28709 6.79373 7.2684 6.81224 7.24986C7.97843 6.08168 9.49227 5.4984 11.0056 5.5C12.2897 5.50137 13.5735 5.92387 14.6442 6.76751C14.6443 6.76761 14.6445 6.7677 14.6446 6.7678C14.6461 6.769 14.6476 6.77019 14.6491 6.77139C14.7691 6.86616 14.8865 6.96622 15.0008 7.07158C15.1146 6.96654 15.2315 6.86675 15.351 6.77223C15.3512 6.7721 15.3513 6.77197 15.3515 6.77184C15.3526 6.77097 15.3537 6.7701 15.3548 6.76923C16.423 5.92599 17.7068 5.50244 18.9916 5.50009C20.5301 5.49728 22.0699 6.09837 23.2427 7.30593C25.5046 9.63712 25.5826 13.3498 23.4787 15.7714ZM21.8267 8.7583C23.3169 10.2932 23.3935 12.7377 22.0244 14.3586C22.0229 14.3605 22.0213 14.3624 22.0197 14.3643L14.9998 21.5901L7.97995 14.3632C7.97863 14.3617 7.97731 14.3601 7.97599 14.3586C7.97594 14.3585 7.97588 14.3584 7.97582 14.3584C6.60713 12.7384 6.68347 10.2903 8.17195 8.76036C8.18416 8.7478 8.19701 8.73477 8.2094 8.72236C8.21008 8.72167 8.21076 8.72099 8.21143 8.72032C9.70479 7.22657 12.0631 7.16434 13.6249 8.56484C13.6284 8.56801 13.632 8.57118 13.6355 8.57436C13.6456 8.58354 13.6558 8.59277 13.6658 8.60207L15.0018 9.83242L16.3368 8.60104C16.3448 8.59365 16.3528 8.5863 16.3609 8.57899C16.3665 8.57387 16.3722 8.56877 16.3778 8.56368C16.4631 8.48711 16.5508 8.41492 16.6406 8.3471C18.191 7.17644 20.3799 7.30895 21.7878 8.71882C21.8008 8.73187 21.8138 8.74503 21.8267 8.7583Z" fill="#9CA0A9"></path></svg></div></div><span style="opacity:0;position:absolute">Избранное</span></span><span class="header-style__DisabledHeaderBottomButtonText-sc-4e7756a5-19 iJsmLC">Избранное</span></div></div><div class="header-style__HeaderBottomButton-sc-4e7756a5-21 bzNOWg cart"><div class="popover-style__StyledPopover-sc-5f84575-1 eeUyMx right POPOVER"><a class="header-style__HeaderBottomButtonIcon-sc-4e7756a5-16 iXqeVh cart" href="/cart"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="30" height="30" viewBox="0 0 30 30" fill="none" xmlns="http://www.w3.org/2000/svg"><path fill-rule="evenodd" clip-rule="evenodd" d="M4 4H6.79729C7.77422 4 8.62579 4.66489 8.86273 5.61265L9.67615 8.86632H24.1983C25.3742 8.86632 26.3274 9.81951 26.3274 10.9953V15.1775C26.3274 16.1145 25.7147 16.9414 24.8182 17.2142L12.7154 20.8977C11.539 21.2557 10.3048 20.5455 10.0231 19.3485L7.85833 10.1481L6.85025 6.11577C6.84417 6.09147 6.82233 6.07442 6.79729 6.07442H4V4ZM10.1759 10.9407L12.0424 18.8734C12.0496 18.9041 12.0813 18.9223 12.1115 18.9131L24.2142 15.2297C24.2372 15.2227 24.2529 15.2015 24.2529 15.1775V10.9953C24.2529 10.9652 24.2285 10.9407 24.1983 10.9407H10.1759Z" fill="#E64E8D"></path><path d="M12.1883 24.0348C12.1883 25.1202 11.3084 26.0001 10.2231 26.0001C9.13768 26.0001 8.25781 25.1202 8.25781 24.0348C8.25781 22.9494 9.13768 22.0696 10.2231 22.0696C11.3084 22.0696 12.1883 22.9494 12.1883 24.0348Z" fill="#E64E8D"></path><path d="M24.3543 24.0348C24.3543 25.1202 23.4744 26.0001 22.3891 26.0001C21.3037 26.0001 20.4238 25.1202 20.4238 24.0348C20.4238 22.9494 21.3037 22.0696 22.3891 22.0696C23.4744 22.0696 24.3543 22.9494 24.3543 24.0348Z" fill="#E64E8D"></path></svg></div><span style="opacity:0;position:absolute">Корзина</span></a><a href="/cart" class="header-style__HeaderBottomButtonText-sc-4e7756a5-18 jlSEZZ">Корзина</a></div></div><div class="header-style__HeaderBottomButton-sc-4e7756a5-21 bzNOWg"><a href="#" class="header-style__HeaderBottomButtonIcon-sc-4e7756a5-16 iXqeVh"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="30" height="30" viewBox="0 0 30 30" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M24.7056 23.4216C22.4396 21.5162 18.9337 20.2939 14.9997 20.2939C11.0653 20.2939 7.56009 21.5156 5.29432 23.4211C4.76788 23.8638 4.98288 24.5808 5.65942 24.8474L5.80393 24.9044C6.29099 25.0963 6.86666 24.9859 7.2594 24.6789C9.07313 23.2611 11.8666 22.3523 14.9997 22.3523C18.1331 22.3523 20.9267 23.2613 22.7404 24.6793C23.1329 24.9861 23.7082 25.0966 24.1951 24.905L24.3399 24.8481C25.017 24.5817 25.2323 23.8645 24.7056 23.4216Z" fill="currentColor"></path><path fill-rule="evenodd" clip-rule="evenodd" d="M15 15.4565C17.2013 15.4565 18.9859 13.6719 18.9859 11.4706C18.9859 9.26924 17.2013 7.4847 15 7.4847C12.7987 7.4847 11.0141 9.26924 11.0141 11.4706C11.0141 13.6719 12.7987 15.4565 15 15.4565ZM15 17.9412C18.5736 17.9412 21.4706 15.0442 21.4706 11.4706C21.4706 7.89698 18.5736 5 15 5C11.4264 5 8.52942 7.89698 8.52942 11.4706C8.52942 15.0442 11.4264 17.9412 15 17.9412Z" fill="currentColor"></path></svg></div><span style="opacity:0;position:absolute">Вход</span></a><a href="#" class="header-style__HeaderBottomButtonText-sc-4e7756a5-18 jlSEZZ">Вход</a></div></div></div></div></div><div class="categories-menu-style__StyledCategoriesMenu-sc-436e8be3-0 hfCLxk"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><noindex><div class="categories-menu-style__CategoriesMenuContent-sc-436e8be3-1 ciDiHu"><a href="/c/pnevmoinstrumenti" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/8KAib67TuoLXc7vWkqd-uDxOg62_uXx87at4Cpx7TN8/f:webp/czM6Ly9pbWFnZXMvYmMvMzIvYzYvY2IvYzMzNGNiOGMucG5n" alt="Пневмоинструменты" title="Пневмоинструменты" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Пневмоинструменты</div></a><a href="/c/svarochnoe-oborudovanie" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/L9uejm_nqyYuFNwoVV6HnXhBDc3nleTJTn2OulZVT0s/f:webp/czM6Ly9pbWFnZXMvYmUvZTUvODEvMmMvODY1ZWQyM2MucG5n" alt="Сварочное оборудование" title="Сварочное оборудование" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Сварочное оборудование</div></a><a href="/c/oborudovanie-dlya-salonov-krasoti" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/KrSfUYIL7skoEh1y0wiRQ-eBnokFgj9sDkfvX8j1otI/f:webp/czM6Ly9pbWFnZXMvZWEvMzgvODUvZTUvOWVkMjk4OWEucG5n" alt="Оборудование для салонов красоты" title="Оборудование для салонов красоты" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Оборудование для салонов красоты</div></a><a href="/c/rashodnie-materiali-i-osnastka" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/Dj3k3xyX75pZ3BNQttWbZ9UKZCcRLl2J0ptL-awGf4w/f:webp/czM6Ly9pbWFnZXMvYmMvOTMvYzMvNmMvMTZhNTM5ZDIucG5n" alt="Расходные материалы и оснастка" title="Расходные материалы и оснастка" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Расходные материалы и оснастка</div></a><a href="/c/elektroinstrumenti" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/DzJVzj-6HK-oAmVKq34OM2Zo80UUKrxC5KugXOXBTpA/f:webp/czM6Ly9pbWFnZXMvZTgvOWUvOTcvNjEvOTYyNmNlMjYucG5n" alt="Электроинструменты" title="Электроинструменты" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Электроинструменты</div></a><a href="/c/osnastka-k-sadovoy-tehnike" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/S69mO5Dz0mUtxm5MYSJA19--OFkp_vE2edcGMwQaqQs/f:webp/czM6Ly9pbWFnZXMvZWEvNGIvNTkvZGIvNDc4Yzg1MzQucG5n" alt="Оснастка к садовой технике" title="Оснастка к садовой технике" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Оснастка к садовой технике</div></a><a href="/c/moyki-vd-i-aksessuari" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/Pyb_33h8Y2UmZvBbOIgPfCZiyCjTUwUYd8yAckc3daU/f:webp/czM6Ly9pbWFnZXMvYmMvYzcvYzYvY2MvOTQzOGMxMzcucG5n" alt="Мойки ВД и аксессуары" title="Мойки ВД и аксессуары" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Мойки ВД и аксессуары</div></a><a href="/c/nasosi-i-komplektuyushhie" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/fJyRE9IHUAJz1_8Ouz67GxO0i5r-bfTmqcIbHyg-8qI/f:webp/czM6Ly9pbWFnZXMvYjMvYzMvOTkvMmMvYzkzMmNjY2QucG5n" alt="Насосы и комплектующие" title="Насосы и комплектующие" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Насосы и комплектующие</div></a><a href="/c/ruchnoy-instrument" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/S69mO5Dz0mUtxm5MYSJA19--OFkp_vE2edcGMwQaqQs/f:webp/czM6Ly9pbWFnZXMvZWEvNGIvNTkvZGIvNDc4Yzg1MzQucG5n" alt="Ручной инструмент" title="Ручной инструмент" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Ручной инструмент</div></a><a href="/c/uhod-za-nogtyami" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/WX4D6qkJUbLnGir0Hkynl7VpHWduG4Eh1AtKaHMKtVw/f:webp/czM6Ly9pbWFnZXMvYzUvZTgvNmEvODcvMzI5NjJmMWIucG5n" alt="Уход за ногтями" title="Уход за ногтями" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Уход за ногтями</div></a><a href="/c/prigotovlenie-blyud" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/t5wPzRDtxQ1gpHIT1ZjnKN_F-zkvkl-4z37g3S1qxeM/f:webp/czM6Ly9pbWFnZXMvYjAvNGIvNGMvNzQvYjQzNzliMzMucG5n" alt="Приготовление блюд" title="Приготовление блюд" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Приготовление блюд</div></a><a href="/c/izmeritelniy-instrument" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/NQ6SzwSg_ueXIyt45buvebLapYH7nIp9hIu_7kCMlnk/f:webp/czM6Ly9pbWFnZXMvOTAvZjgvMzUvOWUvMjcwY2NlNzMucG5n" alt="Измерительный инструмент" title="Измерительный инструмент" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Измерительный инструмент</div></a><a href="/c/elektro-i-benzopili" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/ZCrvRR-eJgaC-8OcvWaWvEqmsMgZkJRTl-RGbOqtAzo/f:webp/czM6Ly9pbWFnZXMvYjMvZjIvODAvNmYvNGJiMGE2NzgucG5n" alt="Электро- и бензопилы" title="Электро- и бензопилы" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Электро- и бензопилы</div></a><a href="/c/nasosi-dlya-podkachki-shin" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/cE6VsyCi98tahszKeUyvmckh_DaIGz9Mikixc2blqhM/f:webp/czM6Ly9pbWFnZXMvYjQvYTcvYzcvOTgvOWI3NThhMzAucG5n" alt="Насосы для подкачки шин" title="Насосы для подкачки шин" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Насосы для подкачки шин</div></a><a href="/c/kormlenie" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/WK3dXqy7sP5mZ0HrMMWCSQixd86vF97TovdCPRV2Gf4/f:webp/czM6Ly9pbWFnZXMvYjAvNzkvY2YvYzYvODM5MjkyYzcucG5n" alt="Кормление" title="Кормление" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Кормление</div></a><a href="/c/kuhonnie-aksessuari" class="category-menu-item-style__StyledCategoryMenuItem-sc-f40419f1-2 iEBwwG"><div class="category-menu-item-style__CategoryMenuItemImage-sc-f40419f1-0 fbpxga"><img src="https://static.dgm-online.ru/flMab0CuM3UlwpqFKso_bBDqHRL_LAWetYYqUm1gKTA/f:webp/czM6Ly9pbWFnZXMvYjAvNGQvY2YvOTIvY2YzMGNkNjEucG5n" alt="Кухонные аксессуары" title="Кухонные аксессуары" style="object-fit:contain"/></div><div class="category-menu-item-style__CategoryMenuItemText-sc-f40419f1-1 iVjvUh">Кухонные аксессуары</div></a></div></noindex></div></div></header><div class="wrapper-style__PageContainer-sc-53eabab1-2 hcGrsc"><section class="header-style__HeaderBottomGreyZone-sc-4e7756a5-2 ekBzgO"><section class="bannder-slider-style__StyledBannderSlider-sc-633dc9b1-4 vrCjr noInit"><div class="bannder-slider-style__ArrowsContainer-sc-633dc9b1-2 boDCLE"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG bannder-slider-style__PrevSlide-sc-633dc9b1-0 QGoTg" style="width:38px;height:38px" aria-label="Предыдущий слайд"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG bannder-slider-style__NextSlide-sc-633dc9b1-1 dkYIfc" style="width:38px;height:38px" aria-label="Следующий слайд"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button></div></div><div class="swiper"><div class="swiper-pagination"></div><div class="swiper-wrapper"><div class="swiper-slide swiper-slide-duplicate" data-swiper-slide-index="3"><section data-no-hydrate="true"><div class="banner-slide-style__StyledBannerSlide-sc-184eb57d-11 frbYED slide-3"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="banner-slide-style__Relative-sc-184eb57d-0 kbDXsX"><div class="banner-slide-style__SlideLeft-sc-184eb57d-1 jxSkLT"><div class="banner-slide-style__SlideTitle-sc-184eb57d-3 iAhzWd noMargin"><span>Это действительно удобно,</span><div class="banner-slide-style__SlideSubtitle-sc-184eb57d-2 irkRbX">просто попробуйте</div></div><div class="banner-slide-style__SlideText-sc-184eb57d-6 ZiecM">Мы спроектировали весь процесс покупки так, чтобы у вас не возникало ни одного вопроса, оформите заказ и получите предложение.</div><div class="banner-slide-style__SlideButton-sc-184eb57d-9 jObpwA"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN">Подробнее о сервисе</button></div></div><div class="banner-slide-style__Illustration-sc-184eb57d-10 bpZnNT"><img alt="DGM" title="DGM" width="750" height="560" src="/pics/illustrations/banner4.svg"/></div><div class="banner-slide-style__SlideFakePagination-sc-184eb57d-7 ymxBq"></div></div></div></div></section></div><div class="swiper-slide" data-swiper-slide-index="0"><section data-no-hydrate="true"><div class="banner-slide-style__StyledBannerSlide-sc-184eb57d-11 frbYED slide-0"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="banner-slide-style__Relative-sc-184eb57d-0 kbDXsX"><div class="banner-slide-style__SlideLeft-sc-184eb57d-1 jxSkLT"><h1 class="banner-slide-style__FirstSlideTitle-sc-184eb57d-4 kNzOMw"><span>Поможем купить  товары бренда  «DGM» </span><div class="banner-slide-style__SlideSubtitle-sc-184eb57d-2 irkRbX first">на лучших условиях  <span>в Москве</span></div></h1><div class="banner-slide-style__SlideFeatures-sc-184eb57d-5 cjfsRf"><div class="banner-slide-style__SlideFeature-sc-184eb57d-8 kKYSjk">Объединяем всех продавцов бренда в одном месте</div><div class="banner-slide-style__SlideFeature-sc-184eb57d-8 kKYSjk">Обеспечиваем наиболее выгодные покупки</div><div class="banner-slide-style__SlideFeature-sc-184eb57d-8 kKYSjk">Это действительно удобно, просто попробуйте</div></div><div class="banner-slide-style__SlideButton-sc-184eb57d-9 jObpwA"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN">Подробнее о сервисе</button></div></div><div class="banner-slide-style__Illustration-sc-184eb57d-10 bpZnNT"><img alt="DGM" title="DGM" width="750" height="560" src="/pics/illustrations/banner1.svg"/></div><div class="banner-slide-style__SlideFakePagination-sc-184eb57d-7 ymxBq"></div></div></div></div></section></div><div class="swiper-slide" data-swiper-slide-index="1"><section data-no-hydrate="true"><div class="banner-slide-style__StyledBannerSlide-sc-184eb57d-11 fshcKV slide-1"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="banner-slide-style__Relative-sc-184eb57d-0 kbDXsX"><div class="banner-slide-style__SlideLeft-sc-184eb57d-1 jxSkLT"><div class="banner-slide-style__SlideTitle-sc-184eb57d-3 iAhzWd"><span>Объединяем всех продавцов бренда</span><div class="banner-slide-style__SlideSubtitle-sc-184eb57d-2 irkRbX">в одном месте</div></div><div class="banner-slide-style__SlideText-sc-184eb57d-6 ZiecM">Наша цель - собрать самых активных продавцов &quot;DGM&quot; на данной площадке, чтобы обеспечивать покупателей максимальным выбором лучших предложений со всего рынка.</div><div class="banner-slide-style__SlideButton-sc-184eb57d-9 jObpwA"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN">Подробнее о сервисе</button></div></div><div class="banner-slide-style__Illustration-sc-184eb57d-10 bpZnNT"><img alt="DGM" title="DGM" width="750" height="560" src="/pics/illustrations/banner2.svg"/></div><div class="banner-slide-style__SlideFakePagination-sc-184eb57d-7 ymxBq"></div></div></div></div></section></div><div class="swiper-slide" data-swiper-slide-index="2"><section data-no-hydrate="true"><div class="banner-slide-style__StyledBannerSlide-sc-184eb57d-11 fsIrff slide-2"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="banner-slide-style__Relative-sc-184eb57d-0 kbDXsX"><div class="banner-slide-style__SlideLeft-sc-184eb57d-1 jxSkLT"><div class="banner-slide-style__SlideTitle-sc-184eb57d-3 iAhzWd noMargin"><span>Обеспечиваем наиболее</span><div class="banner-slide-style__SlideSubtitle-sc-184eb57d-2 irkRbX">выгодные покупки</div></div><div class="banner-slide-style__SlideText-sc-184eb57d-6 ZiecM">Покупатели нашего сервиса выбирают наилучшие предложения по цене, доставке и вариациям товаров - благодаря большому количеству получаемых предложений.</div><div class="banner-slide-style__SlideButton-sc-184eb57d-9 jObpwA"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN">Подробнее о сервисе</button></div></div><div class="banner-slide-style__Illustration-sc-184eb57d-10 bpZnNT"><img alt="DGM" title="DGM" width="750" height="560" src="/pics/illustrations/banner3.svg"/></div><div class="banner-slide-style__SlideFakePagination-sc-184eb57d-7 ymxBq"></div></div></div></div></section></div><div class="swiper-slide" data-swiper-slide-index="3"><section data-no-hydrate="true"><div class="banner-slide-style__StyledBannerSlide-sc-184eb57d-11 frbYED slide-3"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="banner-slide-style__Relative-sc-184eb57d-0 kbDXsX"><div class="banner-slide-style__SlideLeft-sc-184eb57d-1 jxSkLT"><div class="banner-slide-style__SlideTitle-sc-184eb57d-3 iAhzWd noMargin"><span>Это действительно удобно,</span><div class="banner-slide-style__SlideSubtitle-sc-184eb57d-2 irkRbX">просто попробуйте</div></div><div class="banner-slide-style__SlideText-sc-184eb57d-6 ZiecM">Мы спроектировали весь процесс покупки так, чтобы у вас не возникало ни одного вопроса, оформите заказ и получите предложение.</div><div class="banner-slide-style__SlideButton-sc-184eb57d-9 jObpwA"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN">Подробнее о сервисе</button></div></div><div class="banner-slide-style__Illustration-sc-184eb57d-10 bpZnNT"><img alt="DGM" title="DGM" width="750" height="560" src="/pics/illustrations/banner4.svg"/></div><div class="banner-slide-style__SlideFakePagination-sc-184eb57d-7 ymxBq"></div></div></div></div></section></div><div class="swiper-slide swiper-slide-duplicate" data-swiper-slide-index="0"><section data-no-hydrate="true"><div class="banner-slide-style__StyledBannerSlide-sc-184eb57d-11 frbYED slide-0"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="banner-slide-style__Relative-sc-184eb57d-0 kbDXsX"><div class="banner-slide-style__SlideLeft-sc-184eb57d-1 jxSkLT"><h1 class="banner-slide-style__FirstSlideTitle-sc-184eb57d-4 kNzOMw"><span>Поможем купить  товары бренда  «DGM» </span><div class="banner-slide-style__SlideSubtitle-sc-184eb57d-2 irkRbX first">на лучших условиях  <span>в Москве</span></div></h1><div class="banner-slide-style__SlideFeatures-sc-184eb57d-5 cjfsRf"><div class="banner-slide-style__SlideFeature-sc-184eb57d-8 kKYSjk">Объединяем всех продавцов бренда в одном месте</div><div class="banner-slide-style__SlideFeature-sc-184eb57d-8 kKYSjk">Обеспечиваем наиболее выгодные покупки</div><div class="banner-slide-style__SlideFeature-sc-184eb57d-8 kKYSjk">Это действительно удобно, просто попробуйте</div></div><div class="banner-slide-style__SlideButton-sc-184eb57d-9 jObpwA"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN">Подробнее о сервисе</button></div></div><div class="banner-slide-style__Illustration-sc-184eb57d-10 bpZnNT"><img alt="DGM" title="DGM" width="750" height="560" src="/pics/illustrations/banner1.svg"/></div><div class="banner-slide-style__SlideFakePagination-sc-184eb57d-7 ymxBq"></div></div></div></div></section></div></div></div></section></section><div class="wrapper-style__Wrapper-sc-53eabab1-1 how-it-works-style__HowItWorksWrapper-sc-f9edb6e1-13 bTABjq jDHRkz"><section class="how-it-works-style__StyledHowItWorks-sc-f9edb6e1-15 gGgWWt"><div class="how-it-works-style__HowItWorksTriangle-sc-f9edb6e1-0 kHkRcX"><div class="how-it-works-style__HowItWorksTriangleSvg-sc-f9edb6e1-1 esRpOA"><svg width="185" height="126" viewBox="0 0 185 126" fill="none" xmlns="http://www.w3.org/2000/svg"><mask id="mask0_802_14796" style="mask-type:alpha" maskUnits="userSpaceOnUse" x="0" y="0" width="185" height="126"><path fill-rule="evenodd" clip-rule="evenodd" d="M183.5 65.4389C184.169 64.2327 184.169 62.7673 183.5 61.5611L150.241 1.54583C149.712 0.59189 148.707 0 147.617 0H3C1.34315 0 0 1.34315 0 3V123C0 124.657 1.34314 126 3 126H148.171C149.262 126 150.266 125.408 150.795 124.454L183.5 65.4389Z" fill="#825BD3"></path></mask><g mask="url(#mask0_802_14796)"><rect x="-77.6746" width="321.081" height="126" rx="3" fill="url(#paint0_linear_802_14796)"></rect></g><defs><linearGradient id="paint0_linear_802_14796" x1="98.0949" y1="-177.188" x2="-146.891" y2="-41.0102" gradientUnits="userSpaceOnUse"><stop stop-color="#785DDB"></stop><stop offset="1" stop-color="#E54E8D"></stop></linearGradient></defs></svg></div><div class="how-it-works-style__HowItWorksTriangleText-sc-f9edb6e1-2 keDHIC">Как это работает?</div></div><div class="how-it-works-style__HowItWorksElements-sc-f9edb6e1-12 eCgoaJ"><div class="how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 clibUU"><div class="how-it-works-style__HowItWorksElementLeft-sc-f9edb6e1-3 bIUEdV"><div class="how-it-works-style__HowItWorksElementIcon-sc-f9edb6e1-5 gijAsE">1</div></div><div class="how-it-works-style__HowItWorksElementRight-sc-f9edb6e1-4 gyJMYo"><div class="how-it-works-style__HowItWorksElementTitle-sc-f9edb6e1-6 brjPc">Выбираете товар</div><div class="how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7 cOllkA">Добавьте интересующие вас товары в корзину</div></div></div><div class="how-it-works-style__HowItWorksElementDivider-sc-f9edb6e1-8 bToiCo"></div><div class="how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 clibUU"><div class="how-it-works-style__HowItWorksElementLeft-sc-f9edb6e1-3 bIUEdV"><div class="how-it-works-style__HowItWorksElementIcon-sc-f9edb6e1-5 gijAsE">2</div></div><div class="how-it-works-style__HowItWorksElementRight-sc-f9edb6e1-4 gyJMYo"><div class="how-it-works-style__HowItWorksElementTitle-sc-f9edb6e1-6 brjPc">Оформляете заказ</div><div class="how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7 cOllkA">Заполните все поля формы, чтобы получить предложение</div></div></div><div class="how-it-works-style__HowItWorksElementDivider-sc-f9edb6e1-8 bToiCo"></div><div class="how-it-works-style__StyledHowItWorksElement-sc-f9edb6e1-9 clibUU"><div class="how-it-works-style__HowItWorksElementLeft-sc-f9edb6e1-3 bIUEdV"><div class="how-it-works-style__HowItWorksElementIcon-sc-f9edb6e1-5 gijAsE">3</div></div><div class="how-it-works-style__HowItWorksElementRight-sc-f9edb6e1-4 gyJMYo"><div class="how-it-works-style__HowItWorksElementTitle-sc-f9edb6e1-6 brjPc">Получаете предложения</div><div class="how-it-works-style__HowItWorksElementDescription-sc-f9edb6e1-7 cOllkA">В ближайшее время с вами свяжется менеджер для уточнения деталей</div></div></div></div></section></div><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div style="margin-bottom:80px"></div><section class="popular-categories-style__StyledPopularCategories-sc-6793409d-10 enCBJz"><h2 class="block-title-style__Title-sc-2857f62c-1 fbLTvi block-title__BlockTitle-sc-1541926b-0 bMsogL">Популярные категории<span class="desktop"><a href="/catalog">16 категорий</a></span> <div class="block-title-style__TitleResponsiveInfo-sc-2857f62c-0 dhQWvG"><span><a href="/catalog">16 категорий</a></span> </div></h2><div class="popular-categories-style__PopularCategoriesContentWrapper-sc-6793409d-1 hkxoVe"><div class="popular-categories-style__PopularCategoriesContent-sc-6793409d-0 gmVlav"><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/pnevmoinstrumenti"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Пневмоинструменты</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">123 товара</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">123 предложения</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/8KAib67TuoLXc7vWkqd-uDxOg62_uXx87at4Cpx7TN8/f:webp/czM6Ly9pbWFnZXMvYmMvMzIvYzYvY2IvYzMzNGNiOGMucG5n" alt="Пневмоинструменты" title="Пневмоинструменты" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/svarochnoe-oborudovanie"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Сварочное оборудование</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">111 товаров</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">111 предложений</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/L9uejm_nqyYuFNwoVV6HnXhBDc3nleTJTn2OulZVT0s/f:webp/czM6Ly9pbWFnZXMvYmUvZTUvODEvMmMvODY1ZWQyM2MucG5n" alt="Сварочное оборудование" title="Сварочное оборудование" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/oborudovanie-dlya-salonov-krasoti"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Оборудование для салонов красоты</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">95 товаров</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">95 предложений</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/KrSfUYIL7skoEh1y0wiRQ-eBnokFgj9sDkfvX8j1otI/f:webp/czM6Ly9pbWFnZXMvZWEvMzgvODUvZTUvOWVkMjk4OWEucG5n" alt="Оборудование для салонов красоты" title="Оборудование для салонов красоты" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/rashodnie-materiali-i-osnastka"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Расходные материалы и оснастка</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">67 товаров</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">67 предложений</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/Dj3k3xyX75pZ3BNQttWbZ9UKZCcRLl2J0ptL-awGf4w/f:webp/czM6Ly9pbWFnZXMvYmMvOTMvYzMvNmMvMTZhNTM5ZDIucG5n" alt="Расходные материалы и оснастка" title="Расходные материалы и оснастка" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/elektroinstrumenti"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Электроинструменты</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">44 товара</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">44 предложения</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/DzJVzj-6HK-oAmVKq34OM2Zo80UUKrxC5KugXOXBTpA/f:webp/czM6Ly9pbWFnZXMvZTgvOWUvOTcvNjEvOTYyNmNlMjYucG5n" alt="Электроинструменты" title="Электроинструменты" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/osnastka-k-sadovoy-tehnike"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Оснастка к садовой технике</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">41 товар</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">41 предложение</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/S69mO5Dz0mUtxm5MYSJA19--OFkp_vE2edcGMwQaqQs/f:webp/czM6Ly9pbWFnZXMvZWEvNGIvNTkvZGIvNDc4Yzg1MzQucG5n" alt="Оснастка к садовой технике" title="Оснастка к садовой технике" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/moyki-vd-i-aksessuari"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Мойки ВД и аксессуары</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">33 товара</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">33 предложения</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/Pyb_33h8Y2UmZvBbOIgPfCZiyCjTUwUYd8yAckc3daU/f:webp/czM6Ly9pbWFnZXMvYmMvYzcvYzYvY2MvOTQzOGMxMzcucG5n" alt="Мойки ВД и аксессуары" title="Мойки ВД и аксессуары" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/nasosi-i-komplektuyushhie"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Насосы и комплектующие</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">32 товара</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">32 предложения</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/fJyRE9IHUAJz1_8Ouz67GxO0i5r-bfTmqcIbHyg-8qI/f:webp/czM6Ly9pbWFnZXMvYjMvYzMvOTkvMmMvYzkzMmNjY2QucG5n" alt="Насосы и комплектующие" title="Насосы и комплектующие" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/ruchnoy-instrument"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Ручной инструмент</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">29 товаров</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">29 предложений</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/S69mO5Dz0mUtxm5MYSJA19--OFkp_vE2edcGMwQaqQs/f:webp/czM6Ly9pbWFnZXMvZWEvNGIvNTkvZGIvNDc4Yzg1MzQucG5n" alt="Ручной инструмент" title="Ручной инструмент" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/uhod-za-nogtyami"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Уход за ногтями</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">23 товара</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">23 предложения</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/WX4D6qkJUbLnGir0Hkynl7VpHWduG4Eh1AtKaHMKtVw/f:webp/czM6Ly9pbWFnZXMvYzUvZTgvNmEvODcvMzI5NjJmMWIucG5n" alt="Уход за ногтями" title="Уход за ногтями" style="object-fit:contain"/></div></a><a class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bpbeBg popular-category__PopularCategory-sc-4802741c-0 cWNpEu" href="/c/prigotovlenie-blyud"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Приготовление блюд</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">16 товаров</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">16 предложений</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><img src="https://static.dgm-online.ru/t5wPzRDtxQ1gpHIT1ZjnKN_F-zkvkl-4z37g3S1qxeM/f:webp/czM6Ly9pbWFnZXMvYjAvNGIvNGMvNzQvYjQzNzliMzMucG5n" alt="Приготовление блюд" title="Приготовление блюд" style="object-fit:contain"/></div></a><a href="/catalog" class="popular-category-style__StyledPopularCategory-sc-bf41b6b-4 bKBfLR"><div class="popular-category-style__PopularCategoryLeft-sc-bf41b6b-0 bARgSC"><div class="popular-category-style__PopularCategoryTitle-sc-bf41b6b-2 jVExFt">Все категории</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt">927<!-- --> <!-- -->товаров</div><div class="popular-category-style__PopularCategorySubtitle-sc-bf41b6b-3 crnwPt offers">927<!-- --> <!-- -->предложений</div></div><div class="popular-category-style__PopularCategoryRight-sc-bf41b6b-1 eCQYtw"><svg width="100" height="100" viewBox="0 0 100 100" fill="none" xmlns="http://www.w3.org/2000/svg"><circle cx="50" cy="50" r="50" fill="#FAFAFA"></circle><path d="M52.5762 49.9999L46.3887 43.8124L48.1562 42.0449L56.1112 49.9999L48.1562 57.9549L46.3887 56.1874L52.5762 49.9999Z" fill="#E64E8D"></path></svg></div></a></div></div><a href="/catalog" class="popular-categories-style__PopularCategoriesShowMoreButton-sc-6793409d-2 jsdiPl"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></section><section class="product-categories-styles__StyledProductCategories-sc-faa38e69-0 kNgBAp false undefined"><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/pnevmoinstrumenti">Пневмоинструменты</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">123 товара</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/pnevmoinstrumenti">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dtp1252-pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125-mm-5-ekscentr.-5-mm-10-000-ob-min-180-l-min" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/gzQAv04RhqBduKIgmNT-m-XMZQOZvoM5GSYOmztK1HI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmQvZDgvZDAvMjUvZDRhOThiOTYucG5n" alt="DTP1252, Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)" title="DTP1252, Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dtp1252-pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125-mm-5-ekscentr.-5-mm-10-000-ob-min-180-l-min"><img src="https://static.dgm-online.ru/gzQAv04RhqBduKIgmNT-m-XMZQOZvoM5GSYOmztK1HI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmQvZDgvZDAvMjUvZDRhOThiOTYucG5n" alt="DTP1252, Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)" title="DTP1252, Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dtp1252-pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125-mm-5-ekscentr.-5-mm-10-000-ob-min-180-l-min" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DTP1252, Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>3 420<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-180-l-min-diametr-kruga-125-mm-davlenie-vozduha-6-bar" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Пневмошлифмашина эксцентриковая DGM DTP-1252 (180 л/мин, диаметр круга 125 мм, давление воздуха 6 бар)" title="Пневмошлифмашина эксцентриковая DGM DTP-1252 (180 л/мин, диаметр круга 125 мм, давление воздуха 6 бар)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-180-l-min-diametr-kruga-125-mm-davlenie-vozduha-6-bar"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Пневмошлифмашина эксцентриковая DGM DTP-1252 (180 л/мин, диаметр круга 125 мм, давление воздуха 6 бар)" title="Пневмошлифмашина эксцентриковая DGM DTP-1252 (180 л/мин, диаметр круга 125 мм, давление воздуха 6 бар)" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-180-l-min-diametr-kruga-125-mm-davlenie-vozduha-6-bar" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пневмошлифмашина эксцентриковая DGM DTP-1252 (180 л/мин, диаметр круга 125 мм, давление воздуха 6 бар)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 990<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/bezmaslyaniy-kompressor-dgm-ac-6100ld" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/Xh45ZSYGR5VMtXxPhcUArOKwv-IhNVx6au7pGp4P3tQ/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvOTMvYzEvNDkvMTMyZDNlZDIucG5n" alt="Безмасляный компрессор DGM AC-6100LD" title="Безмасляный компрессор DGM AC-6100LD" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/bezmaslyaniy-kompressor-dgm-ac-6100ld"><img src="https://static.dgm-online.ru/Xh45ZSYGR5VMtXxPhcUArOKwv-IhNVx6au7pGp4P3tQ/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvOTMvYzEvNDkvMTMyZDNlZDIucG5n" alt="Безмасляный компрессор DGM AC-6100LD" title="Безмасляный компрессор DGM AC-6100LD" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/bezmaslyaniy-kompressor-dgm-ac-6100ld" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Безмасляный компрессор DGM AC-6100LD</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>40 800<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/kompressor-dgm-ac-6100ld" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/Q6uX_LHDgk2fnWEDr-Bl7szj5onD_MKE_0Jp_v6RGMI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMzYvZjEvYzgvZDBjOGI2YzEucG5n" alt="Компрессор DGM AC-6100LD" title="Компрессор DGM AC-6100LD" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/kompressor-dgm-ac-6100ld"><img src="https://static.dgm-online.ru/Q6uX_LHDgk2fnWEDr-Bl7szj5onD_MKE_0Jp_v6RGMI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMzYvZjEvYzgvZDBjOGI2YzEucG5n" alt="Компрессор DGM AC-6100LD" title="Компрессор DGM AC-6100LD" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/kompressor-dgm-ac-6100ld" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Компрессор DGM AC-6100LD</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>38 000<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/kompressor-bezmaslyaniy-dgm-ac-6100ld-2.4-kvt-450-l-min-resiver-100-l-6-cilindrov" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/TyyqzPHoQ1vFsxWZa6TPSJL4YLyjcqKesDJMsnQBZL4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMzYvYzQvNWEvYzBjOGI2Y2IucG5n" alt="Компрессор безмасляный DGM AC-6100LD, 2.4 кВт, 450 л/мин, ресивер 100 л, 6 цилиндров" title="Компрессор безмасляный DGM AC-6100LD, 2.4 кВт, 450 л/мин, ресивер 100 л, 6 цилиндров" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/kompressor-bezmaslyaniy-dgm-ac-6100ld-2.4-kvt-450-l-min-resiver-100-l-6-cilindrov"><img src="https://static.dgm-online.ru/TyyqzPHoQ1vFsxWZa6TPSJL4YLyjcqKesDJMsnQBZL4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMzYvYzQvNWEvYzBjOGI2Y2IucG5n" alt="Компрессор безмасляный DGM AC-6100LD, 2.4 кВт, 450 л/мин, ресивер 100 л, 6 цилиндров" title="Компрессор безмасляный DGM AC-6100LD, 2.4 кВт, 450 л/мин, ресивер 100 л, 6 цилиндров" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/kompressor-bezmaslyaniy-dgm-ac-6100ld-2.4-kvt-450-l-min-resiver-100-l-6-cilindrov" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Компрессор безмасляный DGM AC-6100LD, 2.4 кВт, 450 л/мин, ресивер 100 л, 6 цилиндров</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">16<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>40 800<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/kompressor-dgm-ac-6100ld-bezmaslyaniy-450-l-min-8-atm-koaksialniy-bezmaslyaniy-elektr.-blok-upr.-resiv.-100-l-230-v-24-kvt-dg2720-3" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/TyyqzPHoQ1vFsxWZa6TPSJL4YLyjcqKesDJMsnQBZL4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMzYvYzQvNWEvYzBjOGI2Y2IucG5n" alt="Компрессор DGM AC-6100LD безмасляный (450 л/мин, 8 атм, коаксиальный, безмасляный, электр. блок упр., ресив. 100 л, 230 В, 2,4 кВт) (DG2720-3)" title="Компрессор DGM AC-6100LD безмасляный (450 л/мин, 8 атм, коаксиальный, безмасляный, электр. блок упр., ресив. 100 л, 230 В, 2,4 кВт) (DG2720-3)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/kompressor-dgm-ac-6100ld-bezmaslyaniy-450-l-min-8-atm-koaksialniy-bezmaslyaniy-elektr.-blok-upr.-resiv.-100-l-230-v-24-kvt-dg2720-3"><img src="https://static.dgm-online.ru/TyyqzPHoQ1vFsxWZa6TPSJL4YLyjcqKesDJMsnQBZL4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMzYvYzQvNWEvYzBjOGI2Y2IucG5n" alt="Компрессор DGM AC-6100LD безмасляный (450 л/мин, 8 атм, коаксиальный, безмасляный, электр. блок упр., ресив. 100 л, 230 В, 2,4 кВт) (DG2720-3)" title="Компрессор DGM AC-6100LD безмасляный (450 л/мин, 8 атм, коаксиальный, безмасляный, электр. блок упр., ресив. 100 л, 230 В, 2,4 кВт) (DG2720-3)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/kompressor-dgm-ac-6100ld-bezmaslyaniy-450-l-min-8-atm-koaksialniy-bezmaslyaniy-elektr.-blok-upr.-resiv.-100-l-230-v-24-kvt-dg2720-3" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Компрессор DGM AC-6100LD безмасляный (450 л/мин, 8 атм, коаксиальный, безмасляный, электр. блок упр., ресив. 100 л, 230 В, 2,4 кВт) (DG2720-3)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>42 920<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dtp1252-dgm-pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125-mm-5-ekscentr.-5-mm-10-000-ob-min-180-l-min" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="DTP1252 DGM Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)" title="DTP1252 DGM Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/dtp1252-dgm-pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125-mm-5-ekscentr.-5-mm-10-000-ob-min-180-l-min"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="DTP1252 DGM Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)" title="DTP1252 DGM Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dtp1252-dgm-pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125-mm-5-ekscentr.-5-mm-10-000-ob-min-180-l-min" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DTP1252 DGM Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 987<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/pnevmoshlifmashina-dgm-dtp-1252-ekscentrikovaya" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/u_1OOmxPF82iCx_63wdxGhwIgvH3Bi9FJr07ZbbohTc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmQvNjgvZDIvMzcvYzQ4MThkOTcucG5n" alt="Пневмошлифмашина DGM DTP-1252 эксцентриковая" title="Пневмошлифмашина DGM DTP-1252 эксцентриковая" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/pnevmoshlifmashina-dgm-dtp-1252-ekscentrikovaya"><img src="https://static.dgm-online.ru/u_1OOmxPF82iCx_63wdxGhwIgvH3Bi9FJr07ZbbohTc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmQvNjgvZDIvMzcvYzQ4MThkOTcucG5n" alt="Пневмошлифмашина DGM DTP-1252 эксцентриковая" title="Пневмошлифмашина DGM DTP-1252 эксцентриковая" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/pnevmoshlifmashina-dgm-dtp-1252-ekscentrikovaya" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пневмошлифмашина DGM DTP-1252 эксцентриковая</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 990<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/kompressor-dgm-ac-6100ld-dg2720-3" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/ncvWrYDgp-5BTKspZFZaKuLv4JvQsBza0fTGsd_NmaI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWUvMzYvZDAvYzkvOTI4MTNmMzcucG5n" alt="Компрессор DGM AC-6100LD (DG2720-3)" title="Компрессор DGM AC-6100LD (DG2720-3)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/kompressor-dgm-ac-6100ld-dg2720-3"><img src="https://static.dgm-online.ru/ncvWrYDgp-5BTKspZFZaKuLv4JvQsBza0fTGsd_NmaI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWUvMzYvZDAvYzkvOTI4MTNmMzcucG5n" alt="Компрессор DGM AC-6100LD (DG2720-3)" title="Компрессор DGM AC-6100LD (DG2720-3)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/kompressor-dgm-ac-6100ld-dg2720-3" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Компрессор DGM AC-6100LD (DG2720-3)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">29<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>42 920<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-pnevmoshlifmashina-ekscentrikovaya-dtp-1252" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/6pnfmhZFsTIovqhJxWYytOpXOg1rrv42yyDDFCJM0MA/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjQvYzkvY2IvMzYvYzY4NThkOTYucG5n" alt="DGM Пневмошлифмашина эксцентриковая DTP-1252" title="DGM Пневмошлифмашина эксцентриковая DTP-1252" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-pnevmoshlifmashina-ekscentrikovaya-dtp-1252"><img src="https://static.dgm-online.ru/6pnfmhZFsTIovqhJxWYytOpXOg1rrv42yyDDFCJM0MA/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjQvYzkvY2IvMzYvYzY4NThkOTYucG5n" alt="DGM Пневмошлифмашина эксцентриковая DTP-1252" title="DGM Пневмошлифмашина эксцентриковая DTP-1252" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-pnevmoshlifmashina-ekscentrikovaya-dtp-1252" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Пневмошлифмашина эксцентриковая DTP-1252</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">30<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 990<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/pnevmoinstrumenti" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/svarochnoe-oborudovanie">Сварочное оборудование</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">111 товаров</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/svarochnoe-oborudovanie">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-bp-05d" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/LRreIA6-rnQwg2F2fu6zPeDt-bt_SJO23_xqBoAtLnw/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMzkvYzAvZDYvOGZjNjFiMDYucG5n" alt="DGM BP-05D" title="DGM BP-05D" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-bp-05d"><img src="https://static.dgm-online.ru/LRreIA6-rnQwg2F2fu6zPeDt-bt_SJO23_xqBoAtLnw/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMzkvYzAvZDYvOGZjNjFiMDYucG5n" alt="DGM BP-05D" title="DGM BP-05D" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-bp-05d" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM BP-05D</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 960<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-nasos-drenazhniy-pogruzhnoy-1.5-kvt-bp-a110-v-moskve" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/Iv5mPm8rlmarjKqGQSVvKrA7MucFz-AC6CaWiqlMJ4w/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZDUvNTIvZWUvNTgvOGYyZDMxMGUucG5n" alt="DGM Насос дренажный погружной 1.5 кВт BP-A110 в Москве" title="DGM Насос дренажный погружной 1.5 кВт BP-A110 в Москве" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-nasos-drenazhniy-pogruzhnoy-1.5-kvt-bp-a110-v-moskve"><img src="https://static.dgm-online.ru/Iv5mPm8rlmarjKqGQSVvKrA7MucFz-AC6CaWiqlMJ4w/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZDUvNTIvZWUvNTgvOGYyZDMxMGUucG5n" alt="DGM Насос дренажный погружной 1.5 кВт BP-A110 в Москве" title="DGM Насос дренажный погружной 1.5 кВт BP-A110 в Москве" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-nasos-drenazhniy-pogruzhnoy-1.5-kvt-bp-a110-v-moskve" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Насос дренажный погружной 1.5 кВт BP-A110 в Москве</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">18<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>9 710<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/plazmorez-dgm-cut-40" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/kFc8fxgSDY68qT90jC8M8OUR1-mF6VVCYjpNtgvtRfQ/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmYvZTUvZTAvNjIvZDIxZThhMWMucG5n" alt="Плазморез DGM CUT-40" title="Плазморез DGM CUT-40" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/plazmorez-dgm-cut-40"><img src="https://static.dgm-online.ru/kFc8fxgSDY68qT90jC8M8OUR1-mF6VVCYjpNtgvtRfQ/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmYvZTUvZTAvNjIvZDIxZThhMWMucG5n" alt="Плазморез DGM CUT-40" title="Плазморез DGM CUT-40" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/plazmorez-dgm-cut-40" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Плазморез DGM CUT-40</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>18 900<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/apparat-plazmennoy-rezki-dgm-cut-40" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/ao8dwRFqHDtP5S5WQzGzpQOBFoYAjBErruii6FkpAKs/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjgvNmMvYzcvNjQvYzk5YWM2YzkucG5n" alt="Аппарат плазменной резки DGM CUT-40" title="Аппарат плазменной резки DGM CUT-40" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/apparat-plazmennoy-rezki-dgm-cut-40"><img src="https://static.dgm-online.ru/ao8dwRFqHDtP5S5WQzGzpQOBFoYAjBErruii6FkpAKs/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjgvNmMvYzcvNjQvYzk5YWM2YzkucG5n" alt="Аппарат плазменной резки DGM CUT-40" title="Аппарат плазменной резки DGM CUT-40" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/apparat-plazmennoy-rezki-dgm-cut-40" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Аппарат плазменной резки DGM CUT-40</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>18 340<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-cut-40-plazmorez" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/9IACVxhcksUj2L1YfXcAWQlpKgIADbCZAOMBxNqTZco/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmUvYzQvYzEvNjIvZDI2YTkzM2UucG5n" alt="DGM CUT-40 Плазморез" title="DGM CUT-40 Плазморез" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-cut-40-plazmorez"><img src="https://static.dgm-online.ru/9IACVxhcksUj2L1YfXcAWQlpKgIADbCZAOMBxNqTZco/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmUvYzQvYzEvNjIvZDI2YTkzM2UucG5n" alt="DGM CUT-40 Плазморез" title="DGM CUT-40 Плазморез" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-cut-40-plazmorez" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM CUT-40 Плазморез</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>17 490<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/d7Pi3NmZy-yQnWztoM5_VbQtLusz18BPNUXMZGmNczA/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmUvZTQvYzEvNjIvZDIxZThiOWMucG5n" alt="Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)" title="Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig"><img src="https://static.dgm-online.ru/d7Pi3NmZy-yQnWztoM5_VbQtLusz18BPNUXMZGmNczA/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmUvZTQvYzEvNjIvZDIxZThiOWMucG5n" alt="Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)" title="Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>19 120<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig-dg5820-1" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/7QYzKW7ErZPs60BkK3u49UwHoPi3x2bZZBXvULPnsj4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOWUvNzkvNjEvODYvOTY1OTk5NjUucG5n" alt="Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг) (DG5820-1)" title="Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг) (DG5820-1)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig-dg5820-1"><img src="https://static.dgm-online.ru/7QYzKW7ErZPs60BkK3u49UwHoPi3x2bZZBXvULPnsj4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOWUvNzkvNjEvODYvOTY1OTk5NjUucG5n" alt="Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг) (DG5820-1)" title="Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг) (DG5820-1)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig-dg5820-1" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг) (DG5820-1)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>16 410<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dg58201-plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="DG58201, Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)" title="DG58201, Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/dg58201-plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="DG58201, Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)" title="DG58201, Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dg58201-plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DG58201, Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">29<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>17 700<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-plazmorez-cut-40" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/uC_TN5sX8G3q8LfOgLEGDPWc68UGaBE6VC5epsW6I8Q/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmYvZDIvOTEvM2QvY2EyYjg0OGMucG5n" alt="DGM Плазморез CUT-40" title="DGM Плазморез CUT-40" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-plazmorez-cut-40"><img src="https://static.dgm-online.ru/uC_TN5sX8G3q8LfOgLEGDPWc68UGaBE6VC5epsW6I8Q/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmYvZDIvOTEvM2QvY2EyYjg0OGMucG5n" alt="DGM Плазморез CUT-40" title="DGM Плазморез CUT-40" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-plazmorez-cut-40" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Плазморез CUT-40</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>16 410<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/rezak-plazmenniy-cut-wgc-31-3-m-solaris-analog-pt-31-solaris-pc-40-pc-41-dgm-cut-40-wgc-3130" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/u-s87WzNwilGpE1Z6mlO1TVQ2ebvyxHcASB3NhzyMSI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjgvNGMvODcvYjMvYzQ3ODZjYTUucG5n" alt="Резак плазменный CUT WGC-31 (3 м) SOLARIS (аналог PT-31; Solaris PC-40, PC-41; DGM CUT-40) (WGC-3130)" title="Резак плазменный CUT WGC-31 (3 м) SOLARIS (аналог PT-31; Solaris PC-40, PC-41; DGM CUT-40) (WGC-3130)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/rezak-plazmenniy-cut-wgc-31-3-m-solaris-analog-pt-31-solaris-pc-40-pc-41-dgm-cut-40-wgc-3130"><img src="https://static.dgm-online.ru/u-s87WzNwilGpE1Z6mlO1TVQ2ebvyxHcASB3NhzyMSI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjgvNGMvODcvYjMvYzQ3ODZjYTUucG5n" alt="Резак плазменный CUT WGC-31 (3 м) SOLARIS (аналог PT-31; Solaris PC-40, PC-41; DGM CUT-40) (WGC-3130)" title="Резак плазменный CUT WGC-31 (3 м) SOLARIS (аналог PT-31; Solaris PC-40, PC-41; DGM CUT-40) (WGC-3130)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/rezak-plazmenniy-cut-wgc-31-3-m-solaris-analog-pt-31-solaris-pc-40-pc-41-dgm-cut-40-wgc-3130" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Резак плазменный CUT WGC-31 (3 м) SOLARIS (аналог PT-31; Solaris PC-40, PC-41; DGM CUT-40) (WGC-3130)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">28<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 530<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/svarochnoe-oborudovanie" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/oborudovanie-dlya-salonov-krasoti">Оборудование для салонов красоты</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">95 товаров</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/oborudovanie-dlya-salonov-krasoti">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/paketi-kraft-bumazhnie-dlya-sterilizacii-dgm-steriguard-150250-mm" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/l1Y57b7HeTYGxPkGTIQrEj63VCc3mI-pSJzrcYLgRbY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvYzkvOWUvYjYvOWU2MDQ5NjkucG5n" alt="Пакеты крафт бумажные для стерилизации DGM Steriguard 150*250 мм" title="Пакеты крафт бумажные для стерилизации DGM Steriguard 150*250 мм" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/paketi-kraft-bumazhnie-dlya-sterilizacii-dgm-steriguard-150250-mm"><img src="https://static.dgm-online.ru/l1Y57b7HeTYGxPkGTIQrEj63VCc3mI-pSJzrcYLgRbY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvYzkvOWUvYjYvOWU2MDQ5NjkucG5n" alt="Пакеты крафт бумажные для стерилизации DGM Steriguard 150*250 мм" title="Пакеты крафт бумажные для стерилизации DGM Steriguard 150*250 мм" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/paketi-kraft-bumazhnie-dlya-sterilizacii-dgm-steriguard-150250-mm" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пакеты крафт бумажные для стерилизации DGM Steriguard 150*250 мм</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:99.4px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.2</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>3<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/paketi-dlya-sterilizacii-dgm-steriguard-100h200-mm-korichneviy-100-sht-upk" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/tOMKzKz5iEUrNSNvEa6CtPgEV_XjL53aDZTMU30-6zg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjMvNjQvY2MvMzIvYjNjYzY0NzkucG5n" alt="Пакеты для стерилизации DGM Steriguard, 100х200 мм, коричневый, 100 шт/упк" title="Пакеты для стерилизации DGM Steriguard, 100х200 мм, коричневый, 100 шт/упк" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/paketi-dlya-sterilizacii-dgm-steriguard-100h200-mm-korichneviy-100-sht-upk"><img src="https://static.dgm-online.ru/tOMKzKz5iEUrNSNvEa6CtPgEV_XjL53aDZTMU30-6zg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjMvNjQvY2MvMzIvYjNjYzY0NzkucG5n" alt="Пакеты для стерилизации DGM Steriguard, 100х200 мм, коричневый, 100 шт/упк" title="Пакеты для стерилизации DGM Steriguard, 100х200 мм, коричневый, 100 шт/упк" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/paketi-dlya-sterilizacii-dgm-steriguard-100h200-mm-korichneviy-100-sht-upk" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пакеты для стерилизации DGM Steriguard, 100х200 мм, коричневый, 100 шт/упк</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">17<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>407<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-steriguard-kraft-paket-dlya-sterilizacii-75h150-mm-200-sht" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/F-6-XgAfWDlkO1X-uZ-fU9aC3_c0Me7-zwpgMltu6Cs/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWUvZDMvZDAvMjgvODUyZjdhNzgucG5n" alt="DGM Steriguard, крафт-пакет для стерилизации (75х150 мм), 200 шт" title="DGM Steriguard, крафт-пакет для стерилизации (75х150 мм), 200 шт" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-steriguard-kraft-paket-dlya-sterilizacii-75h150-mm-200-sht"><img src="https://static.dgm-online.ru/F-6-XgAfWDlkO1X-uZ-fU9aC3_c0Me7-zwpgMltu6Cs/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWUvZDMvZDAvMjgvODUyZjdhNzgucG5n" alt="DGM Steriguard, крафт-пакет для стерилизации (75х150 мм), 200 шт" title="DGM Steriguard, крафт-пакет для стерилизации (75х150 мм), 200 шт" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-steriguard-kraft-paket-dlya-sterilizacii-75h150-mm-200-sht" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Steriguard, крафт-пакет для стерилизации (75х150 мм), 200 шт</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">28<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>365<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/sredstvo-dezinficiruyushhee-dlya-pso-i-dvu-easy-oxy-dgm-steriguard" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/csEUZCTM68y0Nrabn_PCzjg9NrjYon4_7hs7_vhNG1k/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOTAvMWYvM2YvM2UvM2E3MDZhZTAucG5n" alt="Средство дезинфицирующее для ПСО и ДВУ EASY Oxy DGM Steriguard" title="Средство дезинфицирующее для ПСО и ДВУ EASY Oxy DGM Steriguard" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/sredstvo-dezinficiruyushhee-dlya-pso-i-dvu-easy-oxy-dgm-steriguard"><img src="https://static.dgm-online.ru/csEUZCTM68y0Nrabn_PCzjg9NrjYon4_7hs7_vhNG1k/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOTAvMWYvM2YvM2UvM2E3MDZhZTAucG5n" alt="Средство дезинфицирующее для ПСО и ДВУ EASY Oxy DGM Steriguard" title="Средство дезинфицирующее для ПСО и ДВУ EASY Oxy DGM Steriguard" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/sredstvo-dezinficiruyushhee-dlya-pso-i-dvu-easy-oxy-dgm-steriguard" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Средство дезинфицирующее для ПСО и ДВУ EASY Oxy DGM Steriguard</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">17<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 744<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-steriguard-indikatori-dlya-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-180s-60-min." class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/46rPrNERQM439at2b8G2LRgQbWkiak21diUCyX-gEL8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWUvNjIvODQvOWQvOWE3MDViNjMucG5n" alt="DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации, класс 4, 180°С/60 мин." title="DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации, класс 4, 180°С/60 мин." style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-steriguard-indikatori-dlya-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-180s-60-min."><img src="https://static.dgm-online.ru/46rPrNERQM439at2b8G2LRgQbWkiak21diUCyX-gEL8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWUvNjIvODQvOWQvOWE3MDViNjMucG5n" alt="DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации, класс 4, 180°С/60 мин." title="DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации, класс 4, 180°С/60 мин." style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-steriguard-indikatori-dlya-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-180s-60-min." class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации, класс 4, 180°С/60 мин.</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>1 440<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-dgm-steriguard-klass-4-tip-a-dlya-vnutr-i-snaruzhi" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Индикатор DGM Steriguard класс 4 тип А для внутр и снаружи" title="Индикатор DGM Steriguard класс 4 тип А для внутр и снаружи" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/indikator-dgm-steriguard-klass-4-tip-a-dlya-vnutr-i-snaruzhi"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Индикатор DGM Steriguard класс 4 тип А для внутр и снаружи" title="Индикатор DGM Steriguard класс 4 тип А для внутр и снаружи" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-dgm-steriguard-klass-4-tip-a-dlya-vnutr-i-snaruzhi" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор DGM Steriguard класс 4 тип А для внутр и снаружи</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">31<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>989<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/chistove-indikator-dgm-steriguard-s-zhurnalom-1000-sht" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/tzzyMPp5iBHNh3HZKE6mUOJN-cgOrLOwBogL_93F36A/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjEvNmMvOGUvOTMvOTljYzg2MzMucG5n" alt="ЧИСТОВЬЕ Индикатор DGM Steriguard с журналом 1000 шт" title="ЧИСТОВЬЕ Индикатор DGM Steriguard с журналом 1000 шт" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/chistove-indikator-dgm-steriguard-s-zhurnalom-1000-sht"><img src="https://static.dgm-online.ru/tzzyMPp5iBHNh3HZKE6mUOJN-cgOrLOwBogL_93F36A/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjEvNmMvOGUvOTMvOTljYzg2MzMucG5n" alt="ЧИСТОВЬЕ Индикатор DGM Steriguard с журналом 1000 шт" title="ЧИСТОВЬЕ Индикатор DGM Steriguard с журналом 1000 шт" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/chistove-indikator-dgm-steriguard-s-zhurnalom-1000-sht" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">ЧИСТОВЬЕ Индикатор DGM Steriguard с журналом 1000 шт</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">18<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>1 912<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-dlya-kontrolya-processa-parovoy-sterilizaciiavtoklav-dgm-steriguard-1000-sht.-s-zhurnalom" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/KV1DncOWUb68VKsLMJWDrDZFI7g6oyx31AemWq2jygk/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTIvYTEvOWQvNWMvOWUzMzYzNjQucG5n" alt="Индикатор для контроля процесса паровой стерилизации(автоклав) &quot;DGM Steriguard&quot; 1000 шт. с журналом" title="Индикатор для контроля процесса паровой стерилизации(автоклав) &quot;DGM Steriguard&quot; 1000 шт. с журналом" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/indikator-dlya-kontrolya-processa-parovoy-sterilizaciiavtoklav-dgm-steriguard-1000-sht.-s-zhurnalom"><img src="https://static.dgm-online.ru/KV1DncOWUb68VKsLMJWDrDZFI7g6oyx31AemWq2jygk/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTIvYTEvOWQvNWMvOWUzMzYzNjQucG5n" alt="Индикатор для контроля процесса паровой стерилизации(автоклав) &quot;DGM Steriguard&quot; 1000 шт. с журналом" title="Индикатор для контроля процесса паровой стерилизации(автоклав) &quot;DGM Steriguard&quot; 1000 шт. с журналом" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-dlya-kontrolya-processa-parovoy-sterilizaciiavtoklav-dgm-steriguard-1000-sht.-s-zhurnalom" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор для контроля процесса паровой стерилизации(автоклав) &quot;DGM Steriguard&quot; 1000 шт. с журналом</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>985<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikatori-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-dgm-steriguard" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/T1gFZ3t3gf325XnM4ha7uJBDtpj8Wo5ZphYqDH5JKjc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvODQvNTgvN2IvYWEvM2JiNDk2YzUucG5n" alt="Индикаторы контроля процесса воздушной стерилизации класс 4 DGM Steriguard" title="Индикаторы контроля процесса воздушной стерилизации класс 4 DGM Steriguard" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/indikatori-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-dgm-steriguard"><img src="https://static.dgm-online.ru/T1gFZ3t3gf325XnM4ha7uJBDtpj8Wo5ZphYqDH5JKjc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvODQvNTgvN2IvYWEvM2JiNDk2YzUucG5n" alt="Индикаторы контроля процесса воздушной стерилизации класс 4 DGM Steriguard" title="Индикаторы контроля процесса воздушной стерилизации класс 4 DGM Steriguard" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikatori-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-dgm-steriguard" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикаторы контроля процесса воздушной стерилизации класс 4 DGM Steriguard</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">28<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>1 560<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-dgm-steriguard-universalniy-s-zhurnalom-dlya-avtoklavov-bumaga--1000-sht-upk--art.601-690" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/zW_0hV5qKjKL180mpgnPBezC7sS_YC9lOGsZmZusEro/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTIvYTMvOTkvY2MvOWU5OTUzMzIucG5n" alt="Индикатор DGM Steriguard универсальный с журналом для автоклавов Бумага , 1000 шт/упк , арт.601-690" title="Индикатор DGM Steriguard универсальный с журналом для автоклавов Бумага , 1000 шт/упк , арт.601-690" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/indikator-dgm-steriguard-universalniy-s-zhurnalom-dlya-avtoklavov-bumaga--1000-sht-upk--art.601-690"><img src="https://static.dgm-online.ru/zW_0hV5qKjKL180mpgnPBezC7sS_YC9lOGsZmZusEro/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTIvYTMvOTkvY2MvOWU5OTUzMzIucG5n" alt="Индикатор DGM Steriguard универсальный с журналом для автоклавов Бумага , 1000 шт/упк , арт.601-690" title="Индикатор DGM Steriguard универсальный с журналом для автоклавов Бумага , 1000 шт/упк , арт.601-690" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-dgm-steriguard-universalniy-s-zhurnalom-dlya-avtoklavov-bumaga--1000-sht-upk--art.601-690" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор DGM Steriguard универсальный с журналом для автоклавов Бумага , 1000 шт/упк , арт.601-690</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>1 540<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/oborudovanie-dlya-salonov-krasoti" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/rashodnie-materiali-i-osnastka">Расходные материалы и оснастка</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">67 товаров</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/rashodnie-materiali-i-osnastka">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/kompressor-bezmaslyaniy-koaksialniy-220v-24kvt-450l-min-100l-8-bar-elektr.-upr.ac-6100ld-dgm-dg2720-3" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Компрессор безмасляный коаксиальный 220V 2,4кВт 450л/мин 100л 8 бар электр. упр.AC-6100LD, DGM DG2720-3" title="Компрессор безмасляный коаксиальный 220V 2,4кВт 450л/мин 100л 8 бар электр. упр.AC-6100LD, DGM DG2720-3" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/kompressor-bezmaslyaniy-koaksialniy-220v-24kvt-450l-min-100l-8-bar-elektr.-upr.ac-6100ld-dgm-dg2720-3"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Компрессор безмасляный коаксиальный 220V 2,4кВт 450л/мин 100л 8 бар электр. упр.AC-6100LD, DGM DG2720-3" title="Компрессор безмасляный коаксиальный 220V 2,4кВт 450л/мин 100л 8 бар электр. упр.AC-6100LD, DGM DG2720-3" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/kompressor-bezmaslyaniy-koaksialniy-220v-24kvt-450l-min-100l-8-bar-elektr.-upr.ac-6100ld-dgm-dg2720-3" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Компрессор безмасляный коаксиальный 220V 2,4кВт 450л/мин 100л 8 бар электр. упр.AC-6100LD, DGM DG2720-3</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>42 920<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/benzopila-perenosnaya-dgm-gs-282-cherno-zelenaya" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/mq_qE7D0_vcL0HqxBKvzcn5xNJGz-snWG6junMSCEog/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmIvZTAvYzQvMWMvN2FkMDk1MmYucG5n" alt="Бензопила переносная DGM GS-282 черно-зеленая" title="Бензопила переносная DGM GS-282 черно-зеленая" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/benzopila-perenosnaya-dgm-gs-282-cherno-zelenaya"><img src="https://static.dgm-online.ru/mq_qE7D0_vcL0HqxBKvzcn5xNJGz-snWG6junMSCEog/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmIvZTAvYzQvMWMvN2FkMDk1MmYucG5n" alt="Бензопила переносная DGM GS-282 черно-зеленая" title="Бензопила переносная DGM GS-282 черно-зеленая" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/benzopila-perenosnaya-dgm-gs-282-cherno-zelenaya" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бензопила переносная DGM GS-282 черно-зеленая</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 180<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/benzinovaya-pila-dgm-gs-282-2800-vt" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/xplif3d4MpPEUVB1Em-fU3ZQtwHjLl-HG5R_W1liF0g/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmIvZjMvODUvMmYvNGE5MGE2NGMucG5n" alt="Бензиновая пила DGM GS-282 2800 Вт" title="Бензиновая пила DGM GS-282 2800 Вт" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/benzinovaya-pila-dgm-gs-282-2800-vt"><img src="https://static.dgm-online.ru/xplif3d4MpPEUVB1Em-fU3ZQtwHjLl-HG5R_W1liF0g/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmIvZjMvODUvMmYvNGE5MGE2NGMucG5n" alt="Бензиновая пила DGM GS-282 2800 Вт" title="Бензиновая пила DGM GS-282 2800 Вт" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/benzinovaya-pila-dgm-gs-282-2800-vt" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бензиновая пила DGM GS-282 2800 Вт</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">29<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>5 190<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/benzopila-dgm-gs-282" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/vweLU4fP1MVL0MFRlHytuh9isBYYPQ2K5o-JltP3oDY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWMvYzYvOTMvM2IvNmFjNDI1MzMucG5n" alt="Бензопила DGM GS-282" title="Бензопила DGM GS-282" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/benzopila-dgm-gs-282"><img src="https://static.dgm-online.ru/vweLU4fP1MVL0MFRlHytuh9isBYYPQ2K5o-JltP3oDY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWMvYzYvOTMvM2IvNmFjNDI1MzMucG5n" alt="Бензопила DGM GS-282" title="Бензопила DGM GS-282" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/benzopila-dgm-gs-282" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бензопила DGM GS-282</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">28<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>6 370<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-gs-282" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="DGM GS-282" title="DGM GS-282" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/dgm-gs-282"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="DGM GS-282" title="DGM GS-282" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-gs-282" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM GS-282</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>4 371<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/benzopila-dgm-gs-282-1.5mm-72zv." class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/bVfqzAMaq8d__HeW15b7ROkqsC4Klo8gO2UM-hteH7E/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWMvYzYvOTMvMTkvNmNjNDk1M2IucG5n" alt="Бензопила DGM GS-282 1.5мм 72зв." title="Бензопила DGM GS-282 1.5мм 72зв." style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/benzopila-dgm-gs-282-1.5mm-72zv."><img src="https://static.dgm-online.ru/bVfqzAMaq8d__HeW15b7ROkqsC4Klo8gO2UM-hteH7E/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWMvYzYvOTMvMTkvNmNjNDk1M2IucG5n" alt="Бензопила DGM GS-282 1.5мм 72зв." title="Бензопила DGM GS-282 1.5мм 72зв." style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/benzopila-dgm-gs-282-1.5mm-72zv." class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бензопила DGM GS-282 1.5мм 72зв.</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 100<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/benzopila-dgm-gs-282-shina-45-sm-18-0.325-1.5-mm-72-zv.-2.80-kvt-ves-6.5-kg" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/r1trev_3proq93AG1Or8B_4ZR1qm6DbaZ1gx4Ql5JYI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjMvZTIvYzQvMGMvN2FkMGIxNmYucG5n" alt="Бензопила DGM GS-282 шина 45 см (18&quot;), 0.325&quot;, 1.5 мм, 72 зв. (2.80 кВт, вес 6.5 кг)" title="Бензопила DGM GS-282 шина 45 см (18&quot;), 0.325&quot;, 1.5 мм, 72 зв. (2.80 кВт, вес 6.5 кг)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/benzopila-dgm-gs-282-shina-45-sm-18-0.325-1.5-mm-72-zv.-2.80-kvt-ves-6.5-kg"><img src="https://static.dgm-online.ru/r1trev_3proq93AG1Or8B_4ZR1qm6DbaZ1gx4Ql5JYI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjMvZTIvYzQvMGMvN2FkMGIxNmYucG5n" alt="Бензопила DGM GS-282 шина 45 см (18&quot;), 0.325&quot;, 1.5 мм, 72 зв. (2.80 кВт, вес 6.5 кг)" title="Бензопила DGM GS-282 шина 45 см (18&quot;), 0.325&quot;, 1.5 мм, 72 зв. (2.80 кВт, вес 6.5 кг)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/benzopila-dgm-gs-282-shina-45-sm-18-0.325-1.5-mm-72-zv.-2.80-kvt-ves-6.5-kg" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бензопила DGM GS-282 шина 45 см (18&quot;), 0.325&quot;, 1.5 мм, 72 зв. (2.80 кВт, вес 6.5 кг)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>6 250<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-bp-a111" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/nq3rYrfKKVNZHmrupmYzy0ymC_a8wgOeNFtMRPOw5DU/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTcvYzIvOTUvNjgvZDMzNGM5NGUucG5n" alt="DGM BP-A111" title="DGM BP-A111" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-bp-a111"><img src="https://static.dgm-online.ru/nq3rYrfKKVNZHmrupmYzy0ymC_a8wgOeNFtMRPOw5DU/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTcvYzIvOTUvNjgvZDMzNGM5NGUucG5n" alt="DGM BP-A111" title="DGM BP-A111" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-bp-a111" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM BP-A111</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 260<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/gidromodul-dlya-chillera-dantex-dgm-pm1p11-3w9-18" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/h3b3zHfn-9FRAxCM9rflB9hWUnjhkbxJhd0yro09Edk/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWIvNmIvOTQvMWUvOTBiN2M5OTAucG5n" alt="Гидромодуль для чиллера Dantex DGM-PM1P1(1-3)W(9-18)" title="Гидромодуль для чиллера Dantex DGM-PM1P1(1-3)W(9-18)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/gidromodul-dlya-chillera-dantex-dgm-pm1p11-3w9-18"><img src="https://static.dgm-online.ru/h3b3zHfn-9FRAxCM9rflB9hWUnjhkbxJhd0yro09Edk/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWIvNmIvOTQvMWUvOTBiN2M5OTAucG5n" alt="Гидромодуль для чиллера Dantex DGM-PM1P1(1-3)W(9-18)" title="Гидромодуль для чиллера Dantex DGM-PM1P1(1-3)W(9-18)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/gidromodul-dlya-chillera-dantex-dgm-pm1p11-3w9-18" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Гидромодуль для чиллера Dantex DGM-PM1P1(1-3)W(9-18)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>174 397<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/gs232-benzopila-dgm-gs-232-shina-40-sm-16-3-8-1.3-mm-57-zv.-2.30-kvt-40sm-16-ves-55-kg" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/hID_TGzW5e7sU1UlttN3LZyJ_16pKaXDaiq1QC2u9OE/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvYjEvZDIvN2EvMGI0NWQ4NmIucG5n" alt="GS232, Бензопила DGM GS-232 шина 40 см (16), 3/8, 1.3 мм, 57 зв. (2.30 кВт, 40см (16), вес 5,5 кг)" title="GS232, Бензопила DGM GS-232 шина 40 см (16), 3/8, 1.3 мм, 57 зв. (2.30 кВт, 40см (16), вес 5,5 кг)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/gs232-benzopila-dgm-gs-232-shina-40-sm-16-3-8-1.3-mm-57-zv.-2.30-kvt-40sm-16-ves-55-kg"><img src="https://static.dgm-online.ru/hID_TGzW5e7sU1UlttN3LZyJ_16pKaXDaiq1QC2u9OE/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvYjEvZDIvN2EvMGI0NWQ4NmIucG5n" alt="GS232, Бензопила DGM GS-232 шина 40 см (16), 3/8, 1.3 мм, 57 зв. (2.30 кВт, 40см (16), вес 5,5 кг)" title="GS232, Бензопила DGM GS-232 шина 40 см (16), 3/8, 1.3 мм, 57 зв. (2.30 кВт, 40см (16), вес 5,5 кг)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/gs232-benzopila-dgm-gs-232-shina-40-sm-16-3-8-1.3-mm-57-zv.-2.30-kvt-40sm-16-ves-55-kg" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">GS232, Бензопила DGM GS-232 шина 40 см (16), 3/8, 1.3 мм, 57 зв. (2.30 кВт, 40см (16), вес 5,5 кг)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">18<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>6 460<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/rashodnie-materiali-i-osnastka" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/elektroinstrumenti">Электроинструменты</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">44 товара</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/elektroinstrumenti">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/ekscentrikovaya-pnevmoshlifmashina-dgm-dtp-1252" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Эксцентриковая пневмошлифмашина DGM DTP-1252" title="Эксцентриковая пневмошлифмашина DGM DTP-1252" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/ekscentrikovaya-pnevmoshlifmashina-dgm-dtp-1252"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Эксцентриковая пневмошлифмашина DGM DTP-1252" title="Эксцентриковая пневмошлифмашина DGM DTP-1252" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/ekscentrikovaya-pnevmoshlifmashina-dgm-dtp-1252" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Эксцентриковая пневмошлифмашина DGM DTP-1252</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 990<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125mm" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/Jm1EGYSP7WRT6ield0Jj1r9QEbKsfcQhs7Ci5jk1Rog/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjQvYzkvYzMvMzYvYzY5NThkOTYucG5n" alt="Пневмошлифмашина эксцентриковая DGM DTP-1252 125мм" title="Пневмошлифмашина эксцентриковая DGM DTP-1252 125мм" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125mm"><img src="https://static.dgm-online.ru/Jm1EGYSP7WRT6ield0Jj1r9QEbKsfcQhs7Ci5jk1Rog/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjQvYzkvYzMvMzYvYzY5NThkOTYucG5n" alt="Пневмошлифмашина эксцентриковая DGM DTP-1252 125мм" title="Пневмошлифмашина эксцентриковая DGM DTP-1252 125мм" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125mm" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пневмошлифмашина эксцентриковая DGM DTP-1252 125мм</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>3 400<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/kompressor-dgm-as-6100ld" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Компрессор DGM АС-6100LD" title="Компрессор DGM АС-6100LD" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/kompressor-dgm-as-6100ld"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Компрессор DGM АС-6100LD" title="Компрессор DGM АС-6100LD" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/kompressor-dgm-as-6100ld" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Компрессор DGM АС-6100LD</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">29<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>40 800<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/shlifovalnaya-mashina-ekscentrikovaya-dgm-dtp-1252-cherno-golubaya-12-h-13-h-215-sm" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Шлифовальная машина эксцентриковая DGM DTP-1252 черно-голубая 12 х 13 х 21,5 см" title="Шлифовальная машина эксцентриковая DGM DTP-1252 черно-голубая 12 х 13 х 21,5 см" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/shlifovalnaya-mashina-ekscentrikovaya-dgm-dtp-1252-cherno-golubaya-12-h-13-h-215-sm"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Шлифовальная машина эксцентриковая DGM DTP-1252 черно-голубая 12 х 13 х 21,5 см" title="Шлифовальная машина эксцентриковая DGM DTP-1252 черно-голубая 12 х 13 х 21,5 см" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/shlifovalnaya-mashina-ekscentrikovaya-dgm-dtp-1252-cherno-golubaya-12-h-13-h-215-sm" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Шлифовальная машина эксцентриковая DGM DTP-1252 черно-голубая 12 х 13 х 21,5 см</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 990<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/mashina-shlifovalnaya-ekscentrikovaya-5-125mm-dgm-dtp-1252" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Машина шлифовальная эксцентриковая 5/125мм, DGM DTP-1252" title="Машина шлифовальная эксцентриковая 5/125мм, DGM DTP-1252" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/mashina-shlifovalnaya-ekscentrikovaya-5-125mm-dgm-dtp-1252"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Машина шлифовальная эксцентриковая 5/125мм, DGM DTP-1252" title="Машина шлифовальная эксцентриковая 5/125мм, DGM DTP-1252" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/mashina-shlifovalnaya-ekscentrikovaya-5-125mm-dgm-dtp-1252" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Машина шлифовальная эксцентриковая 5/125мм, DGM DTP-1252</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">30<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 990<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-v-moskve" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/xwG27CxD8nRYHn4JbrE2L-K3PFu-r41z0A22AeKpK5E/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmQvYzgvZDIvMjUvZDRhOThiOTYucG5n" alt="Пневмошлифмашина эксцентриковая DGM DTP-1252 в Москве" title="Пневмошлифмашина эксцентриковая DGM DTP-1252 в Москве" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-v-moskve"><img src="https://static.dgm-online.ru/xwG27CxD8nRYHn4JbrE2L-K3PFu-r41z0A22AeKpK5E/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmQvYzgvZDIvMjUvZDRhOThiOTYucG5n" alt="Пневмошлифмашина эксцентриковая DGM DTP-1252 в Москве" title="Пневмошлифмашина эксцентриковая DGM DTP-1252 в Москве" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-v-moskve" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пневмошлифмашина эксцентриковая DGM DTP-1252 в Москве</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">17<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>3 499<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/pnevmaticheskaya-shlifmashinka-ekscentrikovaya-125mm-dtp-1252-dgm" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Пневматическая шлифмашинка эксцентриковая 125мм DTP-1252, DGM" title="Пневматическая шлифмашинка эксцентриковая 125мм DTP-1252, DGM" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/pnevmaticheskaya-shlifmashinka-ekscentrikovaya-125mm-dtp-1252-dgm"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Пневматическая шлифмашинка эксцентриковая 125мм DTP-1252, DGM" title="Пневматическая шлифмашинка эксцентриковая 125мм DTP-1252, DGM" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/pnevmaticheskaya-shlifmashinka-ekscentrikovaya-125mm-dtp-1252-dgm" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пневматическая шлифмашинка эксцентриковая 125мм DTP-1252, DGM</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 990<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-dgm-steriguard-134-5-univers.-s-zhur.-dlya-avtoklavov-1000-sht-upak" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/X0VLlV1j2FBTx9neKo4bGIatbRstrVKmmcXi-IrUTaw/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWUvYzIvODQvOWQvOWE3MDViNjMucG5n" alt="Индикатор DGM Steriguard 134/5 универс. с жур. для автоклавов 1000 шт/упак" title="Индикатор DGM Steriguard 134/5 универс. с жур. для автоклавов 1000 шт/упак" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/indikator-dgm-steriguard-134-5-univers.-s-zhur.-dlya-avtoklavov-1000-sht-upak"><img src="https://static.dgm-online.ru/X0VLlV1j2FBTx9neKo4bGIatbRstrVKmmcXi-IrUTaw/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWUvYzIvODQvOWQvOWE3MDViNjMucG5n" alt="Индикатор DGM Steriguard 134/5 универс. с жур. для автоклавов 1000 шт/упак" title="Индикатор DGM Steriguard 134/5 универс. с жур. для автоклавов 1000 шт/упак" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-dgm-steriguard-134-5-univers.-s-zhur.-dlya-avtoklavov-1000-sht-upak" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор DGM Steriguard 134/5 универс. с жур. для автоклавов 1000 шт/упак</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>1 147<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-universalniy-s-zhurnalom-dlya-avtoklavov-dgm-steriguard-1000-sht-upak" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/o7mlAVTdWWqn0tTzsHbe3zQRruCpm4Heeh8yjm-UJe8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTIvYTMvOTEvY2MvOWM5OGQzNzYucG5n" alt="Индикатор универсальный с журналом для автоклавов DGM Steriguard 1000 шт/упак" title="Индикатор универсальный с журналом для автоклавов DGM Steriguard 1000 шт/упак" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/indikator-universalniy-s-zhurnalom-dlya-avtoklavov-dgm-steriguard-1000-sht-upak"><img src="https://static.dgm-online.ru/o7mlAVTdWWqn0tTzsHbe3zQRruCpm4Heeh8yjm-UJe8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTIvYTMvOTEvY2MvOWM5OGQzNzYucG5n" alt="Индикатор универсальный с журналом для автоклавов DGM Steriguard 1000 шт/упак" title="Индикатор универсальный с журналом для автоклавов DGM Steriguard 1000 шт/упак" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-universalniy-s-zhurnalom-dlya-avtoklavov-dgm-steriguard-1000-sht-upak" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор универсальный с журналом для автоклавов DGM Steriguard 1000 шт/упак</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">18<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>1 539<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-sterilizacii-dgm-steriguard-vozduh-dlya-ispolzovaniya-vnutri-snaruzhi-180-60-1000-sht" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/cgLc3kTihIJav_y0O15VbDWnimmyhkC3_mfoWzr7r14/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWUvMWMvOTUvZTYvY2NjYzBkM2EucG5n" alt="Индикатор стерилизации DGM Steriguard воздух для использования внутри/снаружи 180/60 1000 шт" title="Индикатор стерилизации DGM Steriguard воздух для использования внутри/снаружи 180/60 1000 шт" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/indikator-sterilizacii-dgm-steriguard-vozduh-dlya-ispolzovaniya-vnutri-snaruzhi-180-60-1000-sht"><img src="https://static.dgm-online.ru/cgLc3kTihIJav_y0O15VbDWnimmyhkC3_mfoWzr7r14/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWUvMWMvOTUvZTYvY2NjYzBkM2EucG5n" alt="Индикатор стерилизации DGM Steriguard воздух для использования внутри/снаружи 180/60 1000 шт" title="Индикатор стерилизации DGM Steriguard воздух для использования внутри/снаружи 180/60 1000 шт" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-sterilizacii-dgm-steriguard-vozduh-dlya-ispolzovaniya-vnutri-snaruzhi-180-60-1000-sht" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор стерилизации DGM Steriguard воздух для использования внутри/снаружи 180/60 1000 шт</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">29<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>490<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/elektroinstrumenti" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/osnastka-k-sadovoy-tehnike">Оснастка к садовой технике</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">41 товар</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/osnastka-k-sadovoy-tehnike">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/benzopila-dgm-gs-282-shina-45sm.-0325-15mm.-72zv." class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/vweLU4fP1MVL0MFRlHytuh9isBYYPQ2K5o-JltP3oDY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWMvYzYvOTMvM2IvNmFjNDI1MzMucG5n" alt="Бензопила DGM GS-282 шина 45см. 0,325 1,5мм. 72зв." title="Бензопила DGM GS-282 шина 45см. 0,325 1,5мм. 72зв." style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/benzopila-dgm-gs-282-shina-45sm.-0325-15mm.-72zv."><img src="https://static.dgm-online.ru/vweLU4fP1MVL0MFRlHytuh9isBYYPQ2K5o-JltP3oDY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWMvYzYvOTMvM2IvNmFjNDI1MzMucG5n" alt="Бензопила DGM GS-282 шина 45см. 0,325 1,5мм. 72зв." title="Бензопила DGM GS-282 шина 45см. 0,325 1,5мм. 72зв." style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/benzopila-dgm-gs-282-shina-45sm.-0325-15mm.-72zv." class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бензопила DGM GS-282 шина 45см. 0,325 1,5мм. 72зв.</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>4 930<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/benzopila-dgm-gs-232-shina-40sm-16-3-8-13mm-57-zvenev" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/xkzfv2RRKg-6vJ1lVu9mf5lO8N77AsC2ZebegIrYvDA/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjIvYTYvYzEvNDcvOTc1Y2M4MWYucG5n" alt="Бензопила DGM GS-232 шина 40см (16&quot;) 3/8&quot;, 1,3мм, 57 звеньев" title="Бензопила DGM GS-232 шина 40см (16&quot;) 3/8&quot;, 1,3мм, 57 звеньев" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/benzopila-dgm-gs-232-shina-40sm-16-3-8-13mm-57-zvenev"><img src="https://static.dgm-online.ru/xkzfv2RRKg-6vJ1lVu9mf5lO8N77AsC2ZebegIrYvDA/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjIvYTYvYzEvNDcvOTc1Y2M4MWYucG5n" alt="Бензопила DGM GS-232 шина 40см (16&quot;) 3/8&quot;, 1,3мм, 57 звеньев" title="Бензопила DGM GS-232 шина 40см (16&quot;) 3/8&quot;, 1,3мм, 57 звеньев" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/benzopila-dgm-gs-232-shina-40sm-16-3-8-13mm-57-zvenev" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бензопила DGM GS-232 шина 40см (16&quot;) 3/8&quot;, 1,3мм, 57 звеньев</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>6 000<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/trimmer-benzinoviy-dgm-bc-210-43sm3-25-l.s-nozh-3t-plus-leska-nerazbornaya-7.3-kg" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/jHZB11DWnsBj1VJm2fxfQLhNexdb3_EpbJ7VatPBwLY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjYvNTIvNWEvZGEvNzI4Y2E4MmIucG5n" alt="Триммер бензиновый DGM BC-210 43см3 2,5 л.с нож 3Т+леска, неразборная, 7.3 кг" title="Триммер бензиновый DGM BC-210 43см3 2,5 л.с нож 3Т+леска, неразборная, 7.3 кг" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/trimmer-benzinoviy-dgm-bc-210-43sm3-25-l.s-nozh-3t-plus-leska-nerazbornaya-7.3-kg"><img src="https://static.dgm-online.ru/jHZB11DWnsBj1VJm2fxfQLhNexdb3_EpbJ7VatPBwLY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjYvNTIvNWEvZGEvNzI4Y2E4MmIucG5n" alt="Триммер бензиновый DGM BC-210 43см3 2,5 л.с нож 3Т+леска, неразборная, 7.3 кг" title="Триммер бензиновый DGM BC-210 43см3 2,5 л.с нож 3Т+леска, неразборная, 7.3 кг" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/trimmer-benzinoviy-dgm-bc-210-43sm3-25-l.s-nozh-3t-plus-leska-nerazbornaya-7.3-kg" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Триммер бензиновый DGM BC-210 43см3 2,5 л.с нож 3Т+леска, неразборная, 7.3 кг</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">27<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>9 800<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/gazonokosilka-dgm-bc-210-cena-kupit-v-moskve-otzivi-harakteristiki-obzor" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/IyFNxCn01oCfWdBO2YrJO5hOZugir0gkjg2U93QP7m4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZDYvNTIvNWEvOTgvZTA4ZmE5YWIucG5n" alt="Газонокосилка DGM BC-210 цена, купить в Москве, отзывы, характеристики, обзор" title="Газонокосилка DGM BC-210 цена, купить в Москве, отзывы, характеристики, обзор" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/gazonokosilka-dgm-bc-210-cena-kupit-v-moskve-otzivi-harakteristiki-obzor"><img src="https://static.dgm-online.ru/IyFNxCn01oCfWdBO2YrJO5hOZugir0gkjg2U93QP7m4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZDYvNTIvNWEvOTgvZTA4ZmE5YWIucG5n" alt="Газонокосилка DGM BC-210 цена, купить в Москве, отзывы, характеристики, обзор" title="Газонокосилка DGM BC-210 цена, купить в Москве, отзывы, характеристики, обзор" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/gazonokosilka-dgm-bc-210-cena-kupit-v-moskve-otzivi-harakteristiki-obzor" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Газонокосилка DGM BC-210 цена, купить в Москве, отзывы, характеристики, обзор</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">27<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>8 768<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-motokosa-bc-210-s-nozhom-i-golovkoy" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/h1KwRpZT8u2tS9tjPC6_yOeMNPS2_dWGMiuiA_scRQg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmEvNDIvZGEvZGEvNjMwY2UxMzUucG5n" alt="DGM Мотокоса BC-210 с ножом и головкой" title="DGM Мотокоса BC-210 с ножом и головкой" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-motokosa-bc-210-s-nozhom-i-golovkoy"><img src="https://static.dgm-online.ru/h1KwRpZT8u2tS9tjPC6_yOeMNPS2_dWGMiuiA_scRQg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmEvNDIvZGEvZGEvNjMwY2UxMzUucG5n" alt="DGM Мотокоса BC-210 с ножом и головкой" title="DGM Мотокоса BC-210 с ножом и головкой" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-motokosa-bc-210-s-nozhom-i-golovkoy" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Мотокоса BC-210 с ножом и головкой</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 520<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/benzinoviy-trimmer-dgm-bc-210" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/li4nzsT31R9Zh-aLtCUx725mbvDcLs1yEIaumQIKZv4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjMvZDIvNWEvOWEvZTAyZmE5MjEucG5n" alt="Бензиновый триммер DGM BC-210" title="Бензиновый триммер DGM BC-210" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/benzinoviy-trimmer-dgm-bc-210"><img src="https://static.dgm-online.ru/li4nzsT31R9Zh-aLtCUx725mbvDcLs1yEIaumQIKZv4/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjMvZDIvNWEvOWEvZTAyZmE5MjEucG5n" alt="Бензиновый триммер DGM BC-210" title="Бензиновый триммер DGM BC-210" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/benzinoviy-trimmer-dgm-bc-210" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бензиновый триммер DGM BC-210</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 925<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/komplekt-dlya-samovsasivaniya-dgm-dgwt900017-bescvetniy" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/UNAg7eui6jsWrzZIyE8ibk5T7Adk-WU193CiKOC4Mmw/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWMvOWIvZTYvNjEvOTI2NjliNDQucG5n" alt="Комплект для самовсасывания DGM (DGWT900017) бесцветный" title="Комплект для самовсасывания DGM (DGWT900017) бесцветный" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/komplekt-dlya-samovsasivaniya-dgm-dgwt900017-bescvetniy"><img src="https://static.dgm-online.ru/UNAg7eui6jsWrzZIyE8ibk5T7Adk-WU193CiKOC4Mmw/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWMvOWIvZTYvNjEvOTI2NjliNDQucG5n" alt="Комплект для самовсасывания DGM (DGWT900017) бесцветный" title="Комплект для самовсасывания DGM (DGWT900017) бесцветный" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/komplekt-dlya-samovsasivaniya-dgm-dgwt900017-bescvetniy" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Комплект для самовсасывания DGM (DGWT900017) бесцветный</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">19<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>750<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-dvigatel-09kvt-bak-25-l-davlenie-25-mpa-ph-271" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/GUNLnqldpFBu9LG-WYaS0-uNvf9f5h7NITNi0GunbMI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjIvY2MvODkvMzMvY2MzMzc3OGMucG5n" alt="Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа) (PH-271)" title="Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа) (PH-271)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-dvigatel-09kvt-bak-25-l-davlenie-25-mpa-ph-271"><img src="https://static.dgm-online.ru/GUNLnqldpFBu9LG-WYaS0-uNvf9f5h7NITNi0GunbMI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjIvY2MvODkvMzMvY2MzMzc3OGMucG5n" alt="Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа) (PH-271)" title="Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа) (PH-271)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-dvigatel-09kvt-bak-25-l-davlenie-25-mpa-ph-271" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа) (PH-271)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>10 990<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-dvigatel-09kvt-bak-25-l-davlenie-25-mpa" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/pe1uDMCuyKuxMZI4eyjm1oU3mG5xWNb__CAA0LQy74E/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZGEvYTUvNzQvNGEvYjU2OTkyNzIucG5n" alt="Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа)" title="Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-dvigatel-09kvt-bak-25-l-davlenie-25-mpa"><img src="https://static.dgm-online.ru/pe1uDMCuyKuxMZI4eyjm1oU3mG5xWNb__CAA0LQy74E/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZGEvYTUvNzQvNGEvYjU2OTkyNzIucG5n" alt="Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа)" title="Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-dvigatel-09kvt-bak-25-l-davlenie-25-mpa" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">26<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>10 320<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/ph271-dgm-opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-09kvt-bak-25-l-davlenie-25-mpa" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="PH271 DGM Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т 0,9кВт, бак 25 л, давление 2,5 МПа)" title="PH271 DGM Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т 0,9кВт, бак 25 л, давление 2,5 МПа)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/ph271-dgm-opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-09kvt-bak-25-l-davlenie-25-mpa"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="PH271 DGM Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т 0,9кВт, бак 25 л, давление 2,5 МПа)" title="PH271 DGM Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т 0,9кВт, бак 25 л, давление 2,5 МПа)" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/ph271-dgm-opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-09kvt-bak-25-l-davlenie-25-mpa" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">PH271 DGM Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т 0,9кВт, бак 25 л, давление 2,5 МПа)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">27<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>11 287<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/osnastka-k-sadovoy-tehnike" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/moyki-vd-i-aksessuari">Мойки ВД и аксессуары</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">33 товара</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/moyki-vd-i-aksessuari">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/ochistitel-visokogo-davleniya-dgm-water-140-1.65-kvt-135-bar-420-l-ch-samovsasivanie-aktivniy-penogenerator-dgwt140001" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/KCLaqy8-sQu9ZszXw2uC0thqS6WNYvZWYDSAllLsYV0/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTUvYzYvOWMvMzQvZTYxOTk5NjYucG5n" alt="Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001)" title="Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/ochistitel-visokogo-davleniya-dgm-water-140-1.65-kvt-135-bar-420-l-ch-samovsasivanie-aktivniy-penogenerator-dgwt140001"><img src="https://static.dgm-online.ru/KCLaqy8-sQu9ZszXw2uC0thqS6WNYvZWYDSAllLsYV0/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTUvYzYvOWMvMzQvZTYxOTk5NjYucG5n" alt="Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001)" title="Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/ochistitel-visokogo-davleniya-dgm-water-140-1.65-kvt-135-bar-420-l-ch-samovsasivanie-aktivniy-penogenerator-dgwt140001" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">27<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 180<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/moyka-visokogo-davleniya-dgm-water-140" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/MW4S6Q5Zl-e8TiqYBnpRUy2yD8SvHCJbOVNfWGlsxkg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOGUvYzcvZTEvY2UvODcxOGYxMzIucG5n" alt="Мойка высокого давления DGM Water 140" title="Мойка высокого давления DGM Water 140" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/moyka-visokogo-davleniya-dgm-water-140"><img src="https://static.dgm-online.ru/MW4S6Q5Zl-e8TiqYBnpRUy2yD8SvHCJbOVNfWGlsxkg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOGUvYzcvZTEvY2UvODcxOGYxMzIucG5n" alt="Мойка высокого давления DGM Water 140" title="Мойка высокого давления DGM Water 140" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/moyka-visokogo-davleniya-dgm-water-140" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Мойка высокого давления DGM Water 140</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">27<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 180<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/komplekt-dlya-samovsasivaniya-dlya-ochistitelya-visokogo-davleniya-dgm-dgwt900017" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/S9riiM2PPJBP9IHI7fUIoj83kCW1dCaWwEHGq6nS3vg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWUvYzEvOTQvMzYvZGI0OTFkYzQucG5n" alt="Комплект для самовсасывания для очистителя высокого давления DGM (DGWT900017)" title="Комплект для самовсасывания для очистителя высокого давления DGM (DGWT900017)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/komplekt-dlya-samovsasivaniya-dlya-ochistitelya-visokogo-davleniya-dgm-dgwt900017"><img src="https://static.dgm-online.ru/S9riiM2PPJBP9IHI7fUIoj83kCW1dCaWwEHGq6nS3vg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWUvYzEvOTQvMzYvZGI0OTFkYzQucG5n" alt="Комплект для самовсасывания для очистителя высокого давления DGM (DGWT900017)" title="Комплект для самовсасывания для очистителя высокого давления DGM (DGWT900017)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/komplekt-dlya-samovsasivaniya-dlya-ochistitelya-visokogo-davleniya-dgm-dgwt900017" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Комплект для самовсасывания для очистителя высокого давления DGM (DGWT900017)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">18<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>522<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/ochistitel-visokogo-davleniya-dgm-water-140-1.65-kvt-135-bar-420-l-ch-samovsasivanie-aktivniy-penogenerator-dgwt140001-dgwt140001" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/NvjYWUfKh98hhBQ5-0osFe6-hmGH2R_Z4GhtDXTbfmg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTgvMTUvMGYvM2EvMzk0NjlkNzkucG5n" alt="Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001) (DGWT140001)" title="Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001) (DGWT140001)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/ochistitel-visokogo-davleniya-dgm-water-140-1.65-kvt-135-bar-420-l-ch-samovsasivanie-aktivniy-penogenerator-dgwt140001-dgwt140001"><img src="https://static.dgm-online.ru/NvjYWUfKh98hhBQ5-0osFe6-hmGH2R_Z4GhtDXTbfmg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTgvMTUvMGYvM2EvMzk0NjlkNzkucG5n" alt="Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001) (DGWT140001)" title="Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001) (DGWT140001)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/ochistitel-visokogo-davleniya-dgm-water-140-1.65-kvt-135-bar-420-l-ch-samovsasivanie-aktivniy-penogenerator-dgwt140001-dgwt140001" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001) (DGWT140001)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">27<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 430<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-ochistitel-visokogo-davleniya-water-140" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/rFESjos25BxIhsuDuDyNFA74Fgity-WiwCC2wRBNuUs/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmMvYzcvYzYvY2MvOTQzOGMxMzcucG5n" alt="DGM Очиститель высокого давления Water 140" title="DGM Очиститель высокого давления Water 140" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-ochistitel-visokogo-davleniya-water-140"><img src="https://static.dgm-online.ru/rFESjos25BxIhsuDuDyNFA74Fgity-WiwCC2wRBNuUs/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmMvYzcvYzYvY2MvOTQzOGMxMzcucG5n" alt="DGM Очиститель высокого давления Water 140" title="DGM Очиститель высокого давления Water 140" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-ochistitel-visokogo-davleniya-water-140" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Очиститель высокого давления Water 140</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">17<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>8 530<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/moyka-visokogo-davleniya-dgm-water-140-dgwt140001-v-moskve" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/qB2he0OskhcePT5gGRpodtfC2E8AR-tbmltiJzhQp9k/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTgvMTUvMGYvM2EvMzE0NjlkZjkucG5n" alt="Мойка высокого давления DGM Water 140 (DGWT140001) в Москве" title="Мойка высокого давления DGM Water 140 (DGWT140001) в Москве" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/moyka-visokogo-davleniya-dgm-water-140-dgwt140001-v-moskve"><img src="https://static.dgm-online.ru/qB2he0OskhcePT5gGRpodtfC2E8AR-tbmltiJzhQp9k/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTgvMTUvMGYvM2EvMzE0NjlkZjkucG5n" alt="Мойка высокого давления DGM Water 140 (DGWT140001) в Москве" title="Мойка высокого давления DGM Water 140 (DGWT140001) в Москве" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/moyka-visokogo-davleniya-dgm-water-140-dgwt140001-v-moskve" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Мойка высокого давления DGM Water 140 (DGWT140001) в Москве</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">29<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 400<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/bitovaya-moyka-dgm-water-160-dgwt160001-cherno-zelenaya-4-nasadki" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/GNPpTmo53mZy8lKJy5eZLdRNRTQxmztKdlnrBLxD0Sk/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvY2MvOWEvMzMvOGM2ZGNiMzIucG5n" alt="Бытовая мойка DGM Water 160 DGWT160001 черно-зеленая 4 насадки" title="Бытовая мойка DGM Water 160 DGWT160001 черно-зеленая 4 насадки" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/bitovaya-moyka-dgm-water-160-dgwt160001-cherno-zelenaya-4-nasadki"><img src="https://static.dgm-online.ru/GNPpTmo53mZy8lKJy5eZLdRNRTQxmztKdlnrBLxD0Sk/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvY2MvOWEvMzMvOGM2ZGNiMzIucG5n" alt="Бытовая мойка DGM Water 160 DGWT160001 черно-зеленая 4 насадки" title="Бытовая мойка DGM Water 160 DGWT160001 черно-зеленая 4 насадки" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/bitovaya-moyka-dgm-water-160-dgwt160001-cherno-zelenaya-4-nasadki" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Бытовая мойка DGM Water 160 DGWT160001 черно-зеленая 4 насадки</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>10 190<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/ochistitel-visokogo-davleniya-dgm-water-160" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/s5sY0W3TTIOjFw433bg3m-FSeuPhVIoUfG1cYgaEpZM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmYvYzgvODcvOWUvZTg0OTY0MzQucG5n" alt="Очиститель высокого давления DGM Water 160" title="Очиститель высокого давления DGM Water 160" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/ochistitel-visokogo-davleniya-dgm-water-160"><img src="https://static.dgm-online.ru/s5sY0W3TTIOjFw433bg3m-FSeuPhVIoUfG1cYgaEpZM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmYvYzgvODcvOWUvZTg0OTY0MzQucG5n" alt="Очиститель высокого давления DGM Water 160" title="Очиститель высокого давления DGM Water 160" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/ochistitel-visokogo-davleniya-dgm-water-160" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Очиститель высокого давления DGM Water 160</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">30<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>11 099<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/ochistitel-visokogo-davleniya-dgm-water-160-2.20-kvt-160-bar-480-l-ch-samovsasivanie-vstroenniy-plus-aktivniy-penogenerator-shhetka-dgwt160001-dgwt160001" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/Ho9eXrZn7Qp1QfKHLn4eKLEIkp2L8SOqGXqbYngGd6g/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmUvY2MvODUvMzUvYzk1MmQ0MzIucG5n" alt="Очиститель высокого давления DGM Water 160 (2.20 кВт, 160 бар, 480 л/ч, самовсасывание, встроенный + активный пеногенератор, щетка) (DGWT160001) (DGWT160001)" title="Очиститель высокого давления DGM Water 160 (2.20 кВт, 160 бар, 480 л/ч, самовсасывание, встроенный + активный пеногенератор, щетка) (DGWT160001) (DGWT160001)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/ochistitel-visokogo-davleniya-dgm-water-160-2.20-kvt-160-bar-480-l-ch-samovsasivanie-vstroenniy-plus-aktivniy-penogenerator-shhetka-dgwt160001-dgwt160001"><img src="https://static.dgm-online.ru/Ho9eXrZn7Qp1QfKHLn4eKLEIkp2L8SOqGXqbYngGd6g/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmUvY2MvODUvMzUvYzk1MmQ0MzIucG5n" alt="Очиститель высокого давления DGM Water 160 (2.20 кВт, 160 бар, 480 л/ч, самовсасывание, встроенный + активный пеногенератор, щетка) (DGWT160001) (DGWT160001)" title="Очиститель высокого давления DGM Water 160 (2.20 кВт, 160 бар, 480 л/ч, самовсасывание, встроенный + активный пеногенератор, щетка) (DGWT160001) (DGWT160001)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/ochistitel-visokogo-davleniya-dgm-water-160-2.20-kvt-160-bar-480-l-ch-samovsasivanie-vstroenniy-plus-aktivniy-penogenerator-shhetka-dgwt160001-dgwt160001" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Очиститель высокого давления DGM Water 160 (2.20 кВт, 160 бар, 480 л/ч, самовсасывание, встроенный + активный пеногенератор, щетка) (DGWT160001) (DGWT160001)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:99.4px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.2</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">18<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>10 150<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/moyka-visokogo-davleniya-dgm-water-160" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/luUNjfvOd2ZFmmGYjUQVa6CzcaWKpTo-WgFRMpGm2VY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmEvMmUvNmEvOTkvNGMxOWU2MzgucG5n" alt="Мойка высокого давления DGM Water 160" title="Мойка высокого давления DGM Water 160" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/moyka-visokogo-davleniya-dgm-water-160"><img src="https://static.dgm-online.ru/luUNjfvOd2ZFmmGYjUQVa6CzcaWKpTo-WgFRMpGm2VY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmEvMmUvNmEvOTkvNGMxOWU2MzgucG5n" alt="Мойка высокого давления DGM Water 160" title="Мойка высокого давления DGM Water 160" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/moyka-visokogo-davleniya-dgm-water-160" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Мойка высокого давления DGM Water 160</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">19<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>8 120<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/moyki-vd-i-aksessuari" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/nasosi-i-komplektuyushhie">Насосы и комплектующие</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">32 товара</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/nasosi-i-komplektuyushhie">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/nasosnaya-stanciya-dgm-bp-1500-1500-vt-3600-l-ch-50-m-5-bar-maks-korpus-nasosa-chugun-bak-24-l" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/-MfoOU7lo1mu9nx1bwRIN_7ut7xu9UieB_xFvco8lS8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvOTQvOTYvNTgvYzNlNzlhNjkucG5n" alt="Насосная станция DGM BP-1500 (1500 Вт, 3600 л/ч, 50 м, 5 бар макс, корпус насоса чугун, бак 24 л)" title="Насосная станция DGM BP-1500 (1500 Вт, 3600 л/ч, 50 м, 5 бар макс, корпус насоса чугун, бак 24 л)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/nasosnaya-stanciya-dgm-bp-1500-1500-vt-3600-l-ch-50-m-5-bar-maks-korpus-nasosa-chugun-bak-24-l"><img src="https://static.dgm-online.ru/-MfoOU7lo1mu9nx1bwRIN_7ut7xu9UieB_xFvco8lS8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvOTQvOTYvNTgvYzNlNzlhNjkucG5n" alt="Насосная станция DGM BP-1500 (1500 Вт, 3600 л/ч, 50 м, 5 бар макс, корпус насоса чугун, бак 24 л)" title="Насосная станция DGM BP-1500 (1500 Вт, 3600 л/ч, 50 м, 5 бар макс, корпус насоса чугун, бак 24 л)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/nasosnaya-stanciya-dgm-bp-1500-1500-vt-3600-l-ch-50-m-5-bar-maks-korpus-nasosa-chugun-bak-24-l" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Насосная станция DGM BP-1500 (1500 Вт, 3600 л/ч, 50 м, 5 бар макс, корпус насоса чугун, бак 24 л)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>10 500<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-nasosnaya-stanciya-bp-1500" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/59HvKSYtDjG38ZP2v44eHp0oTxvI682AnHtL_JcaWP0/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmIvYWQvYWMvMWMvZTBlMTkxNTgucG5n" alt="DGM Насосная станция BP-1500" title="DGM Насосная станция BP-1500" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-nasosnaya-stanciya-bp-1500"><img src="https://static.dgm-online.ru/59HvKSYtDjG38ZP2v44eHp0oTxvI682AnHtL_JcaWP0/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmIvYWQvYWMvMWMvZTBlMTkxNTgucG5n" alt="DGM Насосная станция BP-1500" title="DGM Насосная станция BP-1500" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-nasosnaya-stanciya-bp-1500" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Насосная станция BP-1500</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">26<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>9 640<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-nasosnaya-stanciya-bp-1100" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="DGM Насосная станция BP-1100" title="DGM Насосная станция BP-1100" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/dgm-nasosnaya-stanciya-bp-1100"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="DGM Насосная станция BP-1100" title="DGM Насосная станция BP-1100" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-nasosnaya-stanciya-bp-1100" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Насосная станция BP-1100</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">27<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>9 030<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/nasosnaya-stanciya-dgm-dgm-bp-1100" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Насосная станция DGM DGM BP-1100" title="Насосная станция DGM DGM BP-1100" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/nasosnaya-stanciya-dgm-dgm-bp-1100"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Насосная станция DGM DGM BP-1100" title="Насосная станция DGM DGM BP-1100" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/nasosnaya-stanciya-dgm-dgm-bp-1100" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Насосная станция DGM DGM BP-1100</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>10 110<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/nasosnaya-stanciya-dgm-bp-1100-10" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/gESyzMV6L9oNVsOmA6jPRZYWhrGo2Ub4Yt6EUpLQoOc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjkvODUvYTQvZGUvZDBlMTkzNjgucG5n" alt="Насосная станция DGM BP-1100 (*10)" title="Насосная станция DGM BP-1100 (*10)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/nasosnaya-stanciya-dgm-bp-1100-10"><img src="https://static.dgm-online.ru/gESyzMV6L9oNVsOmA6jPRZYWhrGo2Ub4Yt6EUpLQoOc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjkvODUvYTQvZGUvZDBlMTkzNjgucG5n" alt="Насосная станция DGM BP-1100 (*10)" title="Насосная станция DGM BP-1100 (*10)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/nasosnaya-stanciya-dgm-bp-1100-10" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Насосная станция DGM BP-1100 (*10)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>9 290<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/nasos-pogruzhnoy-dgm-bp-a111-dlya-gryaznoy-vodi-s-izmelchitelem" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/6XWtXIfNiEoY6jSNBlyiNLnvTta4XdD9JVC05LTcYq8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjMvYzMvOTkvMmMvYzkzMmNjY2QucG5n" alt="Насос погружной DGM BP-A111 для грязной воды с измельчителем" title="Насос погружной DGM BP-A111 для грязной воды с измельчителем" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/nasos-pogruzhnoy-dgm-bp-a111-dlya-gryaznoy-vodi-s-izmelchitelem"><img src="https://static.dgm-online.ru/6XWtXIfNiEoY6jSNBlyiNLnvTta4XdD9JVC05LTcYq8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjMvYzMvOTkvMmMvYzkzMmNjY2QucG5n" alt="Насос погружной DGM BP-A111 для грязной воды с измельчителем" title="Насос погружной DGM BP-A111 для грязной воды с измельчителем" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/nasos-pogruzhnoy-dgm-bp-a111-dlya-gryaznoy-vodi-s-izmelchitelem" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Насос погружной DGM BP-A111 для грязной воды с измельчителем</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">30<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>8 390<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/drenazhniy-nasos-dgm-bp-a111" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/NEvw56MtjwQPBnabaUymPgauFKJZw7jvhIyquAkRaSM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTcvYzMvOTIvNjkvOTMzNGM5NGUucG5n" alt="Дренажный насос DGM BP-A111" title="Дренажный насос DGM BP-A111" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/drenazhniy-nasos-dgm-bp-a111"><img src="https://static.dgm-online.ru/NEvw56MtjwQPBnabaUymPgauFKJZw7jvhIyquAkRaSM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTcvYzMvOTIvNjkvOTMzNGM5NGUucG5n" alt="Дренажный насос DGM BP-A111" title="Дренажный насос DGM BP-A111" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/drenazhniy-nasos-dgm-bp-a111" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Дренажный насос DGM BP-A111</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>5 900<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-s-izmelchitelem-2000-vt-18000-lch-pogruzhenie-do-5-m-art.-3920bccf94ec3" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/6XWtXIfNiEoY6jSNBlyiNLnvTta4XdD9JVC05LTcYq8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjMvYzMvOTkvMmMvYzkzMmNjY2QucG5n" alt="Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 лч, погружение до 5 м) (art.: 3920bccf94ec3)" title="Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 лч, погружение до 5 м) (art.: 3920bccf94ec3)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-s-izmelchitelem-2000-vt-18000-lch-pogruzhenie-do-5-m-art.-3920bccf94ec3"><img src="https://static.dgm-online.ru/6XWtXIfNiEoY6jSNBlyiNLnvTta4XdD9JVC05LTcYq8/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjMvYzMvOTkvMmMvYzkzMmNjY2QucG5n" alt="Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 лч, погружение до 5 м) (art.: 3920bccf94ec3)" title="Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 лч, погружение до 5 м) (art.: 3920bccf94ec3)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-s-izmelchitelem-2000-vt-18000-lch-pogruzhenie-do-5-m-art.-3920bccf94ec3" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 лч, погружение до 5 м) (art.: 3920bccf94ec3)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:107.9px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.7</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>9 850<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-s-izmelchitelem-2000-vt-18000-l-ch-pogruzhenie-do-5-m-bp-a111" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/6WWmyjClDI79yIFncf8NRWfTL8p6z8XHBD_W0I4czsY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOGIvN2QvYTIvYTIvZjA2MWE1ZTYucG5n" alt="Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 л/ч, погружение до 5 м) (BP-A111)" title="Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 л/ч, погружение до 5 м) (BP-A111)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-s-izmelchitelem-2000-vt-18000-l-ch-pogruzhenie-do-5-m-bp-a111"><img src="https://static.dgm-online.ru/6WWmyjClDI79yIFncf8NRWfTL8p6z8XHBD_W0I4czsY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOGIvN2QvYTIvYTIvZjA2MWE1ZTYucG5n" alt="Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 л/ч, погружение до 5 м) (BP-A111)" title="Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 л/ч, погружение до 5 м) (BP-A111)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-s-izmelchitelem-2000-vt-18000-l-ch-pogruzhenie-do-5-m-bp-a111" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 л/ч, погружение до 5 м) (BP-A111)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:107.9px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.7</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">15<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>6 800<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-bp-a111" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Насос погружной для грязной воды DGM BP-A111 с измельчителем (BP-A111)" title="Насос погружной для грязной воды DGM BP-A111 с измельчителем (BP-A111)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-bp-a111"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Насос погружной для грязной воды DGM BP-A111 с измельчителем (BP-A111)" title="Насос погружной для грязной воды DGM BP-A111 с измельчителем (BP-A111)" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-bp-a111" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Насос погружной для грязной воды DGM BP-A111 с измельчителем (BP-A111)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 150<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/nasosi-i-komplektuyushhie" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/ruchnoy-instrument">Ручной инструмент</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">29 товаров</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/ruchnoy-instrument">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/motokosa-dgm-bc-210-s-nozhom-i-golovkoy-2.1-kvt-kosilnaya-golovka-nozh-3-zub.-remen-odnolyamochniy-ves-7.3-kg" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/V6K0hlOnolelJ1Wyi3yuJ-NxCWGxFUyFApZrhWKcM9A/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmIvNmEvNGEvMWEvZGEwMmNlZWMucG5n" alt="Мотокоса DGM BC-210 с ножом и головкой (2.1 кВт, косильная головка, нож 3 зуб., ремень однолямочный, вес 7.3 кг)" title="Мотокоса DGM BC-210 с ножом и головкой (2.1 кВт, косильная головка, нож 3 зуб., ремень однолямочный, вес 7.3 кг)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/motokosa-dgm-bc-210-s-nozhom-i-golovkoy-2.1-kvt-kosilnaya-golovka-nozh-3-zub.-remen-odnolyamochniy-ves-7.3-kg"><img src="https://static.dgm-online.ru/V6K0hlOnolelJ1Wyi3yuJ-NxCWGxFUyFApZrhWKcM9A/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmIvNmEvNGEvMWEvZGEwMmNlZWMucG5n" alt="Мотокоса DGM BC-210 с ножом и головкой (2.1 кВт, косильная головка, нож 3 зуб., ремень однолямочный, вес 7.3 кг)" title="Мотокоса DGM BC-210 с ножом и головкой (2.1 кВт, косильная головка, нож 3 зуб., ремень однолямочный, вес 7.3 кг)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/motokosa-dgm-bc-210-s-nozhom-i-golovkoy-2.1-kvt-kosilnaya-golovka-nozh-3-zub.-remen-odnolyamochniy-ves-7.3-kg" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Мотокоса DGM BC-210 с ножом и головкой (2.1 кВт, косильная головка, нож 3 зуб., ремень однолямочный, вес 7.3 кг)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">26<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>10 905<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/motokosa-dgm-bc-210-s-nozhom-i-golovkoy" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/WtiVKYA6ARdqchZF12XFnnNP7UKcubE98qAQiK-z2II/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjYvNTIvNWEvZGEvNjI4Y2E4MmYucG5n" alt="Мотокоса DGM BC-210 с ножом и головкой" title="Мотокоса DGM BC-210 с ножом и головкой" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/motokosa-dgm-bc-210-s-nozhom-i-golovkoy"><img src="https://static.dgm-online.ru/WtiVKYA6ARdqchZF12XFnnNP7UKcubE98qAQiK-z2II/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjYvNTIvNWEvZGEvNjI4Y2E4MmYucG5n" alt="Мотокоса DGM BC-210 с ножом и головкой" title="Мотокоса DGM BC-210 с ножом и головкой" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/motokosa-dgm-bc-210-s-nozhom-i-golovkoy" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Мотокоса DGM BC-210 с ножом и головкой</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 530<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/motokosa-dgm-bc-210-7-420-rub.-kupit-s-dostavkoy-v-moskve-i-regionah-rossii--etalon-bt" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/xSeYyZ7zofpA4cRcQbIqDOsARMW7AL8M4HO2rncopfM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjIvNTIvNWEvZGEvNzIwZWU4MmIucG5n" alt="Мотокоса DGM BC-210 (7 420 руб.) - купить с доставкой в Москве и регионах России | Эталон БТ" title="Мотокоса DGM BC-210 (7 420 руб.) - купить с доставкой в Москве и регионах России | Эталон БТ" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/motokosa-dgm-bc-210-7-420-rub.-kupit-s-dostavkoy-v-moskve-i-regionah-rossii--etalon-bt"><img src="https://static.dgm-online.ru/xSeYyZ7zofpA4cRcQbIqDOsARMW7AL8M4HO2rncopfM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjIvNTIvNWEvZGEvNzIwZWU4MmIucG5n" alt="Мотокоса DGM BC-210 (7 420 руб.) - купить с доставкой в Москве и регионах России | Эталон БТ" title="Мотокоса DGM BC-210 (7 420 руб.) - купить с доставкой в Москве и регионах России | Эталон БТ" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/motokosa-dgm-bc-210-7-420-rub.-kupit-s-dostavkoy-v-moskve-i-regionah-rossii--etalon-bt" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Мотокоса DGM BC-210 (7 420 руб.) - купить с доставкой в Москве и регионах России | Эталон БТ</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">13<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 420<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/https-nailbox.ru-catalog-dezinfektsiya-i-sterilizatsiya-kraft-pakety-kraft-pakety-universalnye-paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/fu3K7-hKRM-O1rSsii2e0sjJF4izFEuHhhF0qXOf6kQ/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWQvNjkvOTIvOTYvOWU5MjQ5NjkucG5n" alt="https://nailbox.ru/catalog/dezinfektsiya-i-sterilizatsiya/kraft-pakety/kraft-pakety-universalnye/paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely/" title="https://nailbox.ru/catalog/dezinfektsiya-i-sterilizatsiya/kraft-pakety/kraft-pakety-universalnye/paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely/" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/https-nailbox.ru-catalog-dezinfektsiya-i-sterilizatsiya-kraft-pakety-kraft-pakety-universalnye-paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely"><img src="https://static.dgm-online.ru/fu3K7-hKRM-O1rSsii2e0sjJF4izFEuHhhF0qXOf6kQ/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWQvNjkvOTIvOTYvOWU5MjQ5NjkucG5n" alt="https://nailbox.ru/catalog/dezinfektsiya-i-sterilizatsiya/kraft-pakety/kraft-pakety-universalnye/paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely/" title="https://nailbox.ru/catalog/dezinfektsiya-i-sterilizatsiya/kraft-pakety/kraft-pakety-universalnye/paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely/" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/https-nailbox.ru-catalog-dezinfektsiya-i-sterilizatsiya-kraft-pakety-kraft-pakety-universalnye-paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">https://nailbox.ru/catalog/dezinfektsiya-i-sterilizatsiya/kraft-pakety/kraft-pakety-universalnye/paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely/</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>65<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/shhitok-svarshhika-dgm-dgm-dg1517-6" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Щиток сварщика DGM DGM DG1517-6" title="Щиток сварщика DGM DGM DG1517-6" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/shhitok-svarshhika-dgm-dgm-dg1517-6"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Щиток сварщика DGM DGM DG1517-6" title="Щиток сварщика DGM DGM DG1517-6" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/shhitok-svarshhika-dgm-dgm-dg1517-6" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Щиток сварщика DGM DGM DG1517-6</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>970<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/maska-svarshhika-so-svetofiltrom-v4000-dgm" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/jOiAAIZiJdh9kyfXWWZ0sg_AwGTzDLsMwLzYhLLbSZU/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjkvZTEvOTQvMjUvY2I5NjhkOTMucG5n" alt="Маска сварщика со светофильтром, V4000, DGM" title="Маска сварщика со светофильтром, V4000, DGM" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/maska-svarshhika-so-svetofiltrom-v4000-dgm"><img src="https://static.dgm-online.ru/jOiAAIZiJdh9kyfXWWZ0sg_AwGTzDLsMwLzYhLLbSZU/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjkvZTEvOTQvMjUvY2I5NjhkOTMucG5n" alt="Маска сварщика со светофильтром, V4000, DGM" title="Маска сварщика со светофильтром, V4000, DGM" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/maska-svarshhika-so-svetofiltrom-v4000-dgm" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Маска сварщика со светофильтром, V4000, DGM</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">27<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>1 816<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/maska-svarochnaya-hameleon-dgm-v7000-cherniy-v7000bl1" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/4HVDL12JOBhOamrVMjeQVmfhJ4iDGYm6CYw-5GTBhGE/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWYvZTIvYTAvNjkvZDUyNTkyOTUucG5n" alt="Маска сварочная хамелеон DGM V7000 черный (V7000BL1)" title="Маска сварочная хамелеон DGM V7000 черный (V7000BL1)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/maska-svarochnaya-hameleon-dgm-v7000-cherniy-v7000bl1"><img src="https://static.dgm-online.ru/4HVDL12JOBhOamrVMjeQVmfhJ4iDGYm6CYw-5GTBhGE/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWYvZTIvYTAvNjkvZDUyNTkyOTUucG5n" alt="Маска сварочная хамелеон DGM V7000 черный (V7000BL1)" title="Маска сварочная хамелеон DGM V7000 черный (V7000BL1)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/maska-svarochnaya-hameleon-dgm-v7000-cherniy-v7000bl1" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Маска сварочная хамелеон DGM V7000 черный (V7000BL1)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>3 470<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/trimmer-dgm-bc-241-s-nozhom-i-golovkoy-2.4-kvt-kosilnaya-golovka-nozh-3-zub.-remen" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/iYYux6bvHamTLoOTmg8yqysHB_xwEUdVzoK31gOIwnc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWIvNGIvNDkvZDkvNjM4Y2M1MzQucG5n" alt="Триммер DGM BC-241 с ножом и головкой (2.4 кВт, косильная головка, нож 3 зуб., ремень)" title="Триммер DGM BC-241 с ножом и головкой (2.4 кВт, косильная головка, нож 3 зуб., ремень)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/trimmer-dgm-bc-241-s-nozhom-i-golovkoy-2.4-kvt-kosilnaya-golovka-nozh-3-zub.-remen"><img src="https://static.dgm-online.ru/iYYux6bvHamTLoOTmg8yqysHB_xwEUdVzoK31gOIwnc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWIvNGIvNDkvZDkvNjM4Y2M1MzQucG5n" alt="Триммер DGM BC-241 с ножом и головкой (2.4 кВт, косильная головка, нож 3 зуб., ремень)" title="Триммер DGM BC-241 с ножом и головкой (2.4 кВт, косильная головка, нож 3 зуб., ремень)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/trimmer-dgm-bc-241-s-nozhom-i-golovkoy-2.4-kvt-kosilnaya-golovka-nozh-3-zub.-remen" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Триммер DGM BC-241 с ножом и головкой (2.4 кВт, косильная головка, нож 3 зуб., ремень)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>7 500<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/motokosa-dgm-bc-241s-s-razbornoy-shtangoy-2.4-kvt-razbornaya-shtanga-kosilnaya-golovka-nozh-3-zub-remen-odnolyamochniy-ves-7.3-kg-dg1509-6" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/2huQ_f5VF-jMV64DoOCmOy27Z3o4_KvLyVmhEJzECeY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZDYvZjAvMTYvOWEvYjEwZmE5MmQucG5n" alt="Мотокоса DGM BC-241S с разборной штангой (2.4 кВт, разборная штанга, косильная головка, нож 3 зуб, ремень однолямочный, вес 7.3 кг) (DG1509-6)" title="Мотокоса DGM BC-241S с разборной штангой (2.4 кВт, разборная штанга, косильная головка, нож 3 зуб, ремень однолямочный, вес 7.3 кг) (DG1509-6)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/motokosa-dgm-bc-241s-s-razbornoy-shtangoy-2.4-kvt-razbornaya-shtanga-kosilnaya-golovka-nozh-3-zub-remen-odnolyamochniy-ves-7.3-kg-dg1509-6"><img src="https://static.dgm-online.ru/2huQ_f5VF-jMV64DoOCmOy27Z3o4_KvLyVmhEJzECeY/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZDYvZjAvMTYvOWEvYjEwZmE5MmQucG5n" alt="Мотокоса DGM BC-241S с разборной штангой (2.4 кВт, разборная штанга, косильная головка, нож 3 зуб, ремень однолямочный, вес 7.3 кг) (DG1509-6)" title="Мотокоса DGM BC-241S с разборной штангой (2.4 кВт, разборная штанга, косильная головка, нож 3 зуб, ремень однолямочный, вес 7.3 кг) (DG1509-6)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/motokosa-dgm-bc-241s-s-razbornoy-shtangoy-2.4-kvt-razbornaya-shtanga-kosilnaya-golovka-nozh-3-zub-remen-odnolyamochniy-ves-7.3-kg-dg1509-6" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Мотокоса DGM BC-241S с разборной штангой (2.4 кВт, разборная штанга, косильная головка, нож 3 зуб, ремень однолямочный, вес 7.3 кг) (DG1509-6)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>9 440<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/motokosa-benzinovaya-3.3-l.s.razemnaya-shtanganozh-3t73-kg.-dgm-bc-241" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/4Jg-R4967mUFKpDGUs6aNafyOHEQpnZG3bZPeH1hBnM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWEvNGIvNTkvZGIvNDc4Yzg1MzQucG5n" alt="Мотокоса бензиновая (3.3 л.с.,разъемная штанга,Нож 3Т,7,3 кг.) DGM BC-241" title="Мотокоса бензиновая (3.3 л.с.,разъемная штанга,Нож 3Т,7,3 кг.) DGM BC-241" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/motokosa-benzinovaya-3.3-l.s.razemnaya-shtanganozh-3t73-kg.-dgm-bc-241"><img src="https://static.dgm-online.ru/4Jg-R4967mUFKpDGUs6aNafyOHEQpnZG3bZPeH1hBnM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWEvNGIvNTkvZGIvNDc4Yzg1MzQucG5n" alt="Мотокоса бензиновая (3.3 л.с.,разъемная штанга,Нож 3Т,7,3 кг.) DGM BC-241" title="Мотокоса бензиновая (3.3 л.с.,разъемная штанга,Нож 3Т,7,3 кг.) DGM BC-241" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/motokosa-benzinovaya-3.3-l.s.razemnaya-shtanganozh-3t73-kg.-dgm-bc-241" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Мотокоса бензиновая (3.3 л.с.,разъемная штанга,Нож 3Т,7,3 кг.) DGM BC-241</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>5 583<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/ruchnoy-instrument" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/uhod-za-nogtyami">Уход за ногтями</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">23 товара</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/uhod-za-nogtyami">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-steriguard-rulon-upakovochniy-ploskiy-100h200-m" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/TsCCSxzvmPz3ePDkuAD2i9N5QvKZdkV4hXLuZrQ8-Sw/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYzUvZTgvNmEvODcvMzI5NjJmMWIucG5n" alt="DGM Steriguard, Рулон упаковочный плоский 100х200 м" title="DGM Steriguard, Рулон упаковочный плоский 100х200 м" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-steriguard-rulon-upakovochniy-ploskiy-100h200-m"><img src="https://static.dgm-online.ru/TsCCSxzvmPz3ePDkuAD2i9N5QvKZdkV4hXLuZrQ8-Sw/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYzUvZTgvNmEvODcvMzI5NjJmMWIucG5n" alt="DGM Steriguard, Рулон упаковочный плоский 100х200 м" title="DGM Steriguard, Рулон упаковочный плоский 100х200 м" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-steriguard-rulon-upakovochniy-ploskiy-100h200-m" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Steriguard, Рулон упаковочный плоский 100х200 м</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">12<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>2 019<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-steriguard-indikator-kontrolya-sterilizacii-klass-4-tip-a-180s-60-min-1000-sht" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/2jdx3GSh3tIf2jaWwOjm9g7Bk-o2zyrmNthKwtTsn_w/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTYvNjMvODYvOWMvOTk2MTY5NjcucG5n" alt="DGM Steriguard, индикатор контроля стерилизации (класс 4 тип А, 180°С-60 мин), 1000 шт" title="DGM Steriguard, индикатор контроля стерилизации (класс 4 тип А, 180°С-60 мин), 1000 шт" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-steriguard-indikator-kontrolya-sterilizacii-klass-4-tip-a-180s-60-min-1000-sht"><img src="https://static.dgm-online.ru/2jdx3GSh3tIf2jaWwOjm9g7Bk-o2zyrmNthKwtTsn_w/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTYvNjMvODYvOWMvOTk2MTY5NjcucG5n" alt="DGM Steriguard, индикатор контроля стерилизации (класс 4 тип А, 180°С-60 мин), 1000 шт" title="DGM Steriguard, индикатор контроля стерилизации (класс 4 тип А, 180°С-60 мин), 1000 шт" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-steriguard-indikator-kontrolya-sterilizacii-klass-4-tip-a-180s-60-min-1000-sht" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Steriguard, индикатор контроля стерилизации (класс 4 тип А, 180°С-60 мин), 1000 шт</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">19<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>1 921<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-dgm-dlya-vozdushnoy-sterilizacii-klass-4-tip" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Индикатор DGM для воздушной стерилизации класс 4 тип" title="Индикатор DGM для воздушной стерилизации класс 4 тип" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/indikator-dgm-dlya-vozdushnoy-sterilizacii-klass-4-tip"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Индикатор DGM для воздушной стерилизации класс 4 тип" title="Индикатор DGM для воздушной стерилизации класс 4 тип" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-dgm-dlya-vozdushnoy-sterilizacii-klass-4-tip" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор DGM для воздушной стерилизации класс 4 тип</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">23<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>4<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-himicheskiy-odnorazoviy-dgm-steriguard-klass-4-tip-180-1chas-1000sht" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/YOmez6P_7C2yl-_wnjK0YQJnROqGgvQURpNurgtGjWM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZGUvNGEvYWQvYTUvNTU1MmUwNWMucG5n" alt="Индикатор химический одноразовый DGM Steriguard класс 4 тип: 180 *\1час (1000шт)" title="Индикатор химический одноразовый DGM Steriguard класс 4 тип: 180 *\1час (1000шт)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/indikator-himicheskiy-odnorazoviy-dgm-steriguard-klass-4-tip-180-1chas-1000sht"><img src="https://static.dgm-online.ru/YOmez6P_7C2yl-_wnjK0YQJnROqGgvQURpNurgtGjWM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZGUvNGEvYWQvYTUvNTU1MmUwNWMucG5n" alt="Индикатор химический одноразовый DGM Steriguard класс 4 тип: 180 *\1час (1000шт)" title="Индикатор химический одноразовый DGM Steriguard класс 4 тип: 180 *\1час (1000шт)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-himicheskiy-odnorazoviy-dgm-steriguard-klass-4-tip-180-1chas-1000sht" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор химический одноразовый DGM Steriguard класс 4 тип: 180 *\1час (1000шт)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>855<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-dlya-kontrolya-processa-sterilizacii-dgm-steriguard-100sht" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/CWuYLImP7j7Z2yh6AXRthuEHLMvXrUXWPN7WwlftaEc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmYvM2YvYzAvYzAvYzA3ODJmYzMucG5n" alt="Индикатор для контроля процесса стерилизации DGM Steriguard 100шт" title="Индикатор для контроля процесса стерилизации DGM Steriguard 100шт" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/indikator-dlya-kontrolya-processa-sterilizacii-dgm-steriguard-100sht"><img src="https://static.dgm-online.ru/CWuYLImP7j7Z2yh6AXRthuEHLMvXrUXWPN7WwlftaEc/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYmYvM2YvYzAvYzAvYzA3ODJmYzMucG5n" alt="Индикатор для контроля процесса стерилизации DGM Steriguard 100шт" title="Индикатор для контроля процесса стерилизации DGM Steriguard 100шт" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-dlya-kontrolya-processa-sterilizacii-dgm-steriguard-100sht" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор для контроля процесса стерилизации DGM Steriguard 100шт</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">28<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>92<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-steriguard-indikator-kontrolya-sterilizacii-klass-4-tip-v2-132s-20-min-1000-sht" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/dnsA2mv0MGmIjf1QbJf6-IMkTmQ3LJvPon-0awRITSs/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOWIvY2UvNjQvMzEvOTBjZWNmODMucG5n" alt="DGM Steriguard, индикатор контроля стерилизации (класс 4 тип В2, 132°С-20 мин), 1000 шт" title="DGM Steriguard, индикатор контроля стерилизации (класс 4 тип В2, 132°С-20 мин), 1000 шт" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-steriguard-indikator-kontrolya-sterilizacii-klass-4-tip-v2-132s-20-min-1000-sht"><img src="https://static.dgm-online.ru/dnsA2mv0MGmIjf1QbJf6-IMkTmQ3LJvPon-0awRITSs/f:webp/rs::192:127/czM6Ly9pbWFnZXMvOWIvY2UvNjQvMzEvOTBjZWNmODMucG5n" alt="DGM Steriguard, индикатор контроля стерилизации (класс 4 тип В2, 132°С-20 мин), 1000 шт" title="DGM Steriguard, индикатор контроля стерилизации (класс 4 тип В2, 132°С-20 мин), 1000 шт" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-steriguard-indikator-kontrolya-sterilizacii-klass-4-tip-v2-132s-20-min-1000-sht" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Steriguard, индикатор контроля стерилизации (класс 4 тип В2, 132°С-20 мин), 1000 шт</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>948<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-steriguard-indikatori-dlya-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-180s-60-min.-100-sht." class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/PpXs4wgrmBh2uTCR2_6obUnqzoeScI593yL7wBIlexU/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjIvYjAvY2MvNjQvOGE4NGZhZmEucG5n" alt="DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации (класс 4, 180С-60 мин., 100 шт.)" title="DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации (класс 4, 180С-60 мин., 100 шт.)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-steriguard-indikatori-dlya-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-180s-60-min.-100-sht."><img src="https://static.dgm-online.ru/PpXs4wgrmBh2uTCR2_6obUnqzoeScI593yL7wBIlexU/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZjIvYjAvY2MvNjQvOGE4NGZhZmEucG5n" alt="DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации (класс 4, 180С-60 мин., 100 шт.)" title="DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации (класс 4, 180С-60 мин., 100 шт.)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-steriguard-indikatori-dlya-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-180s-60-min.-100-sht." class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации (класс 4, 180С-60 мин., 100 шт.)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:99.4px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.2</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>150<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-steriguard-kraft-paket-dlya-sterilizacii-75150-mm-100-sht" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/NM9pTumAv-85WLyOufpiFjf3gjP5etreVE5plZvKqcI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvNGQvOWEvOTIvOWUzOGNkNjkucG5n" alt="DGM Steriguard, крафт-пакет для стерилизации (75*150 мм), 100 шт" title="DGM Steriguard, крафт-пакет для стерилизации (75*150 мм), 100 шт" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-steriguard-kraft-paket-dlya-sterilizacii-75150-mm-100-sht"><img src="https://static.dgm-online.ru/NM9pTumAv-85WLyOufpiFjf3gjP5etreVE5plZvKqcI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZTEvNGQvOWEvOTIvOWUzOGNkNjkucG5n" alt="DGM Steriguard, крафт-пакет для стерилизации (75*150 мм), 100 шт" title="DGM Steriguard, крафт-пакет для стерилизации (75*150 мм), 100 шт" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-steriguard-kraft-paket-dlya-sterilizacii-75150-mm-100-sht" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM Steriguard, крафт-пакет для стерилизации (75*150 мм), 100 шт</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">18<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>203<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/sterilizuyushhee-sredstvo-dgm-steriguard-250ml.-sredstvo-prednaznacheno-dlya-sterilizacii-izdeliy-medicinskogo-naznacheniya-i-razlichnih-materialov-vklyuchaya-endoskopi-pri-ispolzovanii-v-plazmennom-nizkotem" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Стерилизующее средство DGM Steriguard, 250мл. Средство предназначено для стерилизации изделий медицинского назначения и различных материалов (включая эндоскопы) при использовании в плазменном низкотем" title="Стерилизующее средство DGM Steriguard, 250мл. Средство предназначено для стерилизации изделий медицинского назначения и различных материалов (включая эндоскопы) при использовании в плазменном низкотем" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/sterilizuyushhee-sredstvo-dgm-steriguard-250ml.-sredstvo-prednaznacheno-dlya-sterilizacii-izdeliy-medicinskogo-naznacheniya-i-razlichnih-materialov-vklyuchaya-endoskopi-pri-ispolzovanii-v-plazmennom-nizkotem"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Стерилизующее средство DGM Steriguard, 250мл. Средство предназначено для стерилизации изделий медицинского назначения и различных материалов (включая эндоскопы) при использовании в плазменном низкотем" title="Стерилизующее средство DGM Steriguard, 250мл. Средство предназначено для стерилизации изделий медицинского назначения и различных материалов (включая эндоскопы) при использовании в плазменном низкотем" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/sterilizuyushhee-sredstvo-dgm-steriguard-250ml.-sredstvo-prednaznacheno-dlya-sterilizacii-izdeliy-medicinskogo-naznacheniya-i-razlichnih-materialov-vklyuchaya-endoskopi-pri-ispolzovanii-v-plazmennom-nizkotem" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Стерилизующее средство DGM Steriguard, 250мл. Средство предназначено для стерилизации изделий медицинского назначения и различных материалов (включая эндоскопы) при использовании в плазменном низкотем</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>15 150<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/paket-500x670-mm-100-sht-dlya-sterilizacii-usilenniy-kombinirovanniy-dgm" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/q4EE9HOG5YbACa67S00RIfg3_N0Ciakqux5pavPxHwI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMWQvZDUvM2EvMmFjMDJlYzUucG5n" alt="Пакет 500x670 мм 100 шт для стерилизации усиленный комбинированный DGM" title="Пакет 500x670 мм 100 шт для стерилизации усиленный комбинированный DGM" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/paket-500x670-mm-100-sht-dlya-sterilizacii-usilenniy-kombinirovanniy-dgm"><img src="https://static.dgm-online.ru/q4EE9HOG5YbACa67S00RIfg3_N0Ciakqux5pavPxHwI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYWYvMWQvZDUvM2EvMmFjMDJlYzUucG5n" alt="Пакет 500x670 мм 100 шт для стерилизации усиленный комбинированный DGM" title="Пакет 500x670 мм 100 шт для стерилизации усиленный комбинированный DGM" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/paket-500x670-mm-100-sht-dlya-sterilizacii-usilenniy-kombinirovanniy-dgm" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пакет 500x670 мм 100 шт для стерилизации усиленный комбинированный DGM</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:101.1px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.3</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">29<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>65 800<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/uhod-za-nogtyami" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article><article class="product-category-style__StyledProductCategory-sc-770aa322-7 bySyWs"><div class="product-category-style__ProductCategoryLeft-sc-770aa322-0 hAWuOw"><h2 class="product-category-style__ProductCategoryTitle-sc-770aa322-4 izYtQR"><a href="/c/prigotovlenie-blyud">Приготовление блюд</a></h2><div class="product-category-style__ProductCategoryInfo-sc-770aa322-3 iBbhNC"><div class="product-category-style__ProductCategoryCount-sc-770aa322-5 kXuzSN">16 товаров</div><div class="product-category-style__ProductCategoryShowMore-sc-770aa322-6 fa-DHiG"><a href="/c/prigotovlenie-blyud">Смотреть все</a></div></div></div><div class="product-category-style__ProductCategoryRight-sc-770aa322-1 jfpAXR"><section class="product-cards-slider-style__StyledSimilarProducts-sc-288a6fd3-0 ccrltL"><div class="product-cards-slider-style__Slider-sc-288a6fd3-4 gnmxLE"><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__PrevProduct-sc-288a6fd3-2 XQcPa" style="width:38px;height:38px" aria-label="Назад" disabled=""><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.28247 10L12.4075 14.125L11.2291 15.3033L5.9258 10L11.2291 4.69668L12.4075 5.87501L8.28247 10Z" fill="currentColor"></path></svg></div></button><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG product-cards-slider-style__NextProduct-sc-288a6fd3-3 FnzxQ" style="width:38px;height:38px" aria-label="Вперед"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="20" height="20" viewBox="0 0 20 20" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M11.7175 9.99999L7.59253 5.87499L8.77086 4.69666L14.0742 9.99999L8.77086 15.3033L7.59253 14.125L11.7175 9.99999Z" fill="currentColor"></path></svg></div></button><div class="swiper"><div class="swiper-wrapper"><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/indikator-testa-bovi-dik-kontrolniy-paket-ukladka-razoviy-dlya-medicinskoy-parovoy-sterilizacii-marki-dgm-steriguard" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Индикатор теста Бови-Дик контрольный (пакет укладка разовый) для медицинской паровой стерилизации марки &quot;DGM Steriguard&quot;" title="Индикатор теста Бови-Дик контрольный (пакет укладка разовый) для медицинской паровой стерилизации марки &quot;DGM Steriguard&quot;" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/indikator-testa-bovi-dik-kontrolniy-paket-ukladka-razoviy-dlya-medicinskoy-parovoy-sterilizacii-marki-dgm-steriguard"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Индикатор теста Бови-Дик контрольный (пакет укладка разовый) для медицинской паровой стерилизации марки &quot;DGM Steriguard&quot;" title="Индикатор теста Бови-Дик контрольный (пакет укладка разовый) для медицинской паровой стерилизации марки &quot;DGM Steriguard&quot;" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/indikator-testa-bovi-dik-kontrolniy-paket-ukladka-razoviy-dlya-medicinskoy-parovoy-sterilizacii-marki-dgm-steriguard" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Индикатор теста Бови-Дик контрольный (пакет укладка разовый) для медицинской паровой стерилизации марки &quot;DGM Steriguard&quot;</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>251<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/dgm-80-vertikalniy-parovoy-sterilizator-gorizontalniy-75-litrov" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/embzp4jKJpze-mukLcS3NptNQVdxzhrzUZ5WAHkMwtI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjAvNGIvNGMvNzQvYjQzNzliMzMucG5n" alt="DGM 80 — вертикальный паровой стерилизатор горизонтальный (75 литров)" title="DGM 80 — вертикальный паровой стерилизатор горизонтальный (75 литров)" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/dgm-80-vertikalniy-parovoy-sterilizator-gorizontalniy-75-litrov"><img src="https://static.dgm-online.ru/embzp4jKJpze-mukLcS3NptNQVdxzhrzUZ5WAHkMwtI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvYjAvNGIvNGMvNzQvYjQzNzliMzMucG5n" alt="DGM 80 — вертикальный паровой стерилизатор горизонтальный (75 литров)" title="DGM 80 — вертикальный паровой стерилизатор горизонтальный (75 литров)" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/dgm-80-vertikalniy-parovoy-sterilizator-gorizontalniy-75-litrov" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">DGM 80 — вертикальный паровой стерилизатор горизонтальный (75 литров)</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">26<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>120 000<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/kombi-parovarka-miele-dgm-7440-obsw" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/ELVZ6m8xPYR_MgvjwBOpBVydfsASzvgc6mGSMbLZ7TE/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWEvY2IvYzMvMzUvMzQzMmNhY2EucG5n" alt="Комби-пароварка Miele DGM 7440 OBSW" title="Комби-пароварка Miele DGM 7440 OBSW" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/kombi-parovarka-miele-dgm-7440-obsw"><img src="https://static.dgm-online.ru/ELVZ6m8xPYR_MgvjwBOpBVydfsASzvgc6mGSMbLZ7TE/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZWEvY2IvYzMvMzUvMzQzMmNhY2EucG5n" alt="Комби-пароварка Miele DGM 7440 OBSW" title="Комби-пароварка Miele DGM 7440 OBSW" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/kombi-parovarka-miele-dgm-7440-obsw" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Комби-пароварка Miele DGM 7440 OBSW</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">20<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>473 000<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/parovarka-s-svch-dgm-7440-obsw" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/wJnUfL7W6BtMSn84RleZ6ehNil9X6d6TLGcnsEy2TUo/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZGYvYzIvYzEvMzYvNGQ0YWM5OGQucG5n" alt="Пароварка с СВЧ DGM 7440 OBSW" title="Пароварка с СВЧ DGM 7440 OBSW" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/parovarka-s-svch-dgm-7440-obsw"><img src="https://static.dgm-online.ru/wJnUfL7W6BtMSn84RleZ6ehNil9X6d6TLGcnsEy2TUo/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZGYvYzIvYzEvMzYvNGQ0YWM5OGQucG5n" alt="Пароварка с СВЧ DGM 7440 OBSW" title="Пароварка с СВЧ DGM 7440 OBSW" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/parovarka-s-svch-dgm-7440-obsw" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пароварка с СВЧ DGM 7440 OBSW</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>407 601<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/parovarka-s-svch-miele-dgm-7440-edst-clst-nerzhaveyushhaya-stal-bt-premium.ru" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 eNFRBQ"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Пароварка с СВЧ Miele DGM 7440 EDST/CLST (Нержавеющая сталь) - БТ Премиум.ру" title="Пароварка с СВЧ Miele DGM 7440 EDST/CLST (Нержавеющая сталь) - БТ Премиум.ру" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><a href="/p/parovarka-s-svch-miele-dgm-7440-edst-clst-nerzhaveyushhaya-stal-bt-premium.ru"><img src="https://static.dgm-online.ru/7HtgaCC4tCzv4JK59qBqGhQ3wY_fYxykLM8T_9_KHEk/f:webp/rs::192:127/czM6Ly9waWNzL25vcGhvdG9jYXJkLnN2Zw" alt="Пароварка с СВЧ Miele DGM 7440 EDST/CLST (Нержавеющая сталь) - БТ Премиум.ру" title="Пароварка с СВЧ Miele DGM 7440 EDST/CLST (Нержавеющая сталь) - БТ Премиум.ру" style="object-fit:contain"/></a></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/parovarka-s-svch-miele-dgm-7440-edst-clst-nerzhaveyushhaya-stal-bt-premium.ru" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пароварка с СВЧ Miele DGM 7440 EDST/CLST (Нержавеющая сталь) - БТ Премиум.ру</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">22<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>365 000<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/vstraivaemaya-parovarka-miele-dgm-7440-obsw" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/MfyDpkNEvAvJhVcJRRPc62ekWbnRpnIxamvl6-rOpKI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmUvYzMvYzEvMzUvODVjYzg5OGQucG5n" alt="Встраиваемая пароварка Miele DGM 7440 OBSW" title="Встраиваемая пароварка Miele DGM 7440 OBSW" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/vstraivaemaya-parovarka-miele-dgm-7440-obsw"><img src="https://static.dgm-online.ru/MfyDpkNEvAvJhVcJRRPc62ekWbnRpnIxamvl6-rOpKI/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmUvYzMvYzEvMzUvODVjYzg5OGQucG5n" alt="Встраиваемая пароварка Miele DGM 7440 OBSW" title="Встраиваемая пароварка Miele DGM 7440 OBSW" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div><div class="product-card-style__Bullet-sc-7aa9b87e-20 eQfAYH"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/vstraivaemaya-parovarka-miele-dgm-7440-obsw" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Встраиваемая пароварка Miele DGM 7440 OBSW</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">24<!-- --> <!-- -->оценки</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>414 810<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/parovarka-s-svch-miele-dgm-7440-obsidian-black" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/sVF3M9GpPBjDUaLle8A8mdgOXS8ERbdwXUOhIDKDp80/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmUvYzMvYzEvMzYvYzhjYWM4OGQucG5n" alt="Пароварка с СВЧ Miele DGM 7440 Obsidian black" title="Пароварка с СВЧ Miele DGM 7440 Obsidian black" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/parovarka-s-svch-miele-dgm-7440-obsidian-black"><img src="https://static.dgm-online.ru/sVF3M9GpPBjDUaLle8A8mdgOXS8ERbdwXUOhIDKDp80/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmUvYzMvYzEvMzYvYzhjYWM4OGQucG5n" alt="Пароварка с СВЧ Miele DGM 7440 Obsidian black" title="Пароварка с СВЧ Miele DGM 7440 Obsidian black" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/parovarka-s-svch-miele-dgm-7440-obsidian-black" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пароварка с СВЧ Miele DGM 7440 Obsidian black</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">28<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>419 000<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/parovarka-miele-dgm-7440-edst-clst-nerzhaveyushhaya-stal" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/NoHktTAsN92UV9yMJeEFOAGnfaeipEoGhiKntlOXNpM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmEvY2EvODEvMjUvYTVkYWJlMDUucG5n" alt="Пароварка Miele DGM 7440 EDST/CLST Нержавеющая сталь" title="Пароварка Miele DGM 7440 EDST/CLST Нержавеющая сталь" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/parovarka-miele-dgm-7440-edst-clst-nerzhaveyushhaya-stal"><img src="https://static.dgm-online.ru/NoHktTAsN92UV9yMJeEFOAGnfaeipEoGhiKntlOXNpM/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmEvY2EvODEvMjUvYTVkYWJlMDUucG5n" alt="Пароварка Miele DGM 7440 EDST/CLST Нержавеющая сталь" title="Пароварка Miele DGM 7440 EDST/CLST Нержавеющая сталь" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/parovarka-miele-dgm-7440-edst-clst-nerzhaveyushhaya-stal" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пароварка Miele DGM 7440 EDST/CLST Нержавеющая сталь</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:104.5px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.5</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">14<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>308 986<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/kombi-parovarka-miele-dgm-7440-edst-clst" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/4CznszVSWYNlcS_l3gkmoOzv7Al1z_sHEqwK28OcbQg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmUvY2EvYzEvMjUvMjUyNTRhZmEucG5n" alt="Комби-пароварка Miele DGM 7440 EDST/CLST" title="Комби-пароварка Miele DGM 7440 EDST/CLST" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/kombi-parovarka-miele-dgm-7440-edst-clst"><img src="https://static.dgm-online.ru/4CznszVSWYNlcS_l3gkmoOzv7Al1z_sHEqwK28OcbQg/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZmUvY2EvYzEvMjUvMjUyNTRhZmEucG5n" alt="Комби-пароварка Miele DGM 7440 EDST/CLST" title="Комби-пароварка Miele DGM 7440 EDST/CLST" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/kombi-parovarka-miele-dgm-7440-edst-clst" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Комби-пароварка Miele DGM 7440 EDST/CLST</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:102.80000000000001px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.4</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">25<!-- --> <!-- -->оценок</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>434 500<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div><div class="swiper-slide"><article class="product-card-style__StyledProductCard-sc-7aa9b87e-18 gOGslI product-card__ProductCard-sc-6de13d9f-0 eWNTrP"><a href="/p/parovarka-s-svch-dgm-7440-edst-clst" class="product-card-style__ProductCardImage-sc-7aa9b87e-0 ljuySt"><img src="https://static.dgm-online.ru/zhptwj-mpQezEmqwLxxCBgyyYmP2kH_OaDj0-mxF37Q/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZGYvY2EvNDEvMjUvMDRjYWRhZGQucG5n" alt="Пароварка с СВЧ DGM 7440 EDST/CLST" title="Пароварка с СВЧ DGM 7440 EDST/CLST" style="object-fit:contain"/><div class="product-card-slider-style__StyledProductCardSlider-sc-b79903ea-0 bGDRtY"></div></a><div class="product-card-style__ProductCardImageSlider-sc-7aa9b87e-1 ZccgF"><div class="product-card-style__ProductCardImageSlide-sc-7aa9b87e-2 iUSxSR"><a href="/p/parovarka-s-svch-dgm-7440-edst-clst"><img src="https://static.dgm-online.ru/zhptwj-mpQezEmqwLxxCBgyyYmP2kH_OaDj0-mxF37Q/f:webp/rs::192:127/czM6Ly9pbWFnZXMvZGYvY2EvNDEvMjUvMDRjYWRhZGQucG5n" alt="Пароварка с СВЧ DGM 7440 EDST/CLST" title="Пароварка с СВЧ DGM 7440 EDST/CLST" style="object-fit:contain"/></a><div class="product-card-style__Bullets-sc-7aa9b87e-19 efnmSP"><div class="product-card-style__Bullet-sc-7aa9b87e-20 cNxRMn"></div></div></div></div><div class="product-card-style__Labels-sc-7aa9b87e-17 gRAkQO"></div><a href="/p/parovarka-s-svch-dgm-7440-edst-clst" class="product-card-style__ProductCardTitle-sc-7aa9b87e-4 hshmym">Пароварка с СВЧ DGM 7440 EDST/CLST</a><div class="product-card-style__ProductCardRating-sc-7aa9b87e-5 hRpIkX"><div class="rating-stars-style__Rating-sc-a59b5b95-3 akQqE rating-stars__RatingStars-sc-1df7f547-0 egkSkV"><div class="rating-stars-style__Stars-sc-a59b5b95-2 dycFDI hideStarsOnMobileM"><span style="width:106.19999999999999px"><span></span></span></div><div class="rating-stars-style__RatingNumber-sc-a59b5b95-0 fJSRMI">4.6</div><div class="rating-stars-style__Votes-sc-a59b5b95-1 dqmnnP">21<!-- --> <!-- -->оценка</div></div></div><div class="product-card-style__ProductCardPrice-sc-7aa9b87e-9 hPYqn"><div class="product-card-style__ProductCardPriceBlock-sc-7aa9b87e-11 kfCpwQ"><div class="product-card-style__ProductCardPriceBlockLeft-sc-7aa9b87e-12 hFGWvp"><div class="product-card-style__ProductCardPriceValue-sc-7aa9b87e-14 bUzLdl"><span>392 506<!-- --> ₽</span></div></div><div class="product-card-style__ProductCardPriceBlockRight-sc-7aa9b87e-13 hGOFoQ"></div></div></div></article></div></div></div></div></section></div><a href="/c/prigotovlenie-blyud" class="product-category-style__ProductCategoryShowAll-sc-770aa322-2 bmtxUH"><button type="submit" class="button-style__StyledButton-sc-adb9ac65-0 jryakX button__Button-sc-b14c4490-0 eXakZN secondary">Смотреть все</button></a></article></section></div><section class="our-projects-style__StyledOurProjects-sc-fac1caf9-3 ibDZgc"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="our-projects-style__OurProjectsContent-sc-fac1caf9-0 dKmVfa"><div class="our-projects-style__OurProjectsTitle-sc-fac1caf9-1 lbWiPC"><h2 class="block-title-style__Title-sc-2857f62c-1 fbLTvi block-title__BlockTitle-sc-1541926b-0 bMsogL">Наши проекты<!-- --> </h2></div><div class="our-projects-style__OurPorjectItems-sc-fac1caf9-2 ckpDlx"><section data-no-hydrate="true"><article class="our-project-style__StyledOurProject-sc-e545f5a6-0 pFOmo"><div class="our-project-style__OurProjectLink-sc-e545f5a6-1 glfcza"><a href="https://maxi-discount.ru">maxi-discount.ru</a></div><div class="our-project-style__OurProjectTags-sc-e545f5a6-2 ldtvaL"><a class="tag" href="https://maxi-discount.ru/t/avtokreslo-maxi-cosi"><div class="tagText">автокресло maxi cosi</div></a><a class="tag" href="https://maxi-discount.ru/t/avtolyulka-maxi-cosi"><div class="tagText">автолюлька maxi cosi</div></a><a class="tag" href="https://maxi-discount.ru/t/kinder-maxi-king"><div class="tagText">kinder maxi king</div></a><a class="tag" href="https://maxi-discount.ru/t/maxi-cosi-pebble"><div class="tagText">maxi cosi pebble</div></a><a class="tag" href="https://maxi-discount.ru/t/maxi"><div class="tagText">maxi</div></a></div></article></section><section data-no-hydrate="true"><article class="our-project-style__StyledOurProject-sc-e545f5a6-0 pFOmo"><div class="our-project-style__OurProjectLink-sc-e545f5a6-1 glfcza"><a href="https://gree-torg.ru">gree-torg.ru</a></div><div class="our-project-style__OurProjectTags-sc-e545f5a6-2 ldtvaL"><a class="tag" href="https://gree-torg.ru/t/kondicioner-gree"><div class="tagText">кондиционер gree</div></a><a class="tag" href="https://gree-torg.ru/t/gree"><div class="tagText">gree</div></a><a class="tag" href="https://gree-torg.ru/t/split-sistema-gree"><div class="tagText">сплит система gree</div></a><a class="tag" href="https://gree-torg.ru/t/gree-bora-09"><div class="tagText">gree bora 09</div></a><a class="tag" href="https://gree-torg.ru/t/gree-gwh09aaaxa-k3nna2a"><div class="tagText">gree gwh09aaaxa k3nna2a</div></a></div></article></section><section data-no-hydrate="true"><article class="our-project-style__StyledOurProject-sc-e545f5a6-0 pFOmo"><div class="our-project-style__OurProjectLink-sc-e545f5a6-1 glfcza"><a href="https://konigin-torg.ru">konigin-torg.ru</a></div><div class="our-project-style__OurProjectTags-sc-e545f5a6-2 ldtvaL"><a class="tag" href="https://konigin-torg.ru/t/konigin"><div class="tagText">konigin</div></a><a class="tag" href="https://konigin-torg.ru/t/vityazhku-konigin"><div class="tagText">вытяжку konigin</div></a><a class="tag" href="https://konigin-torg.ru/t/konigin-canary-60"><div class="tagText">konigin canary 60</div></a><a class="tag" href="https://konigin-torg.ru/t/ugolniy-filtr-dlya-vityazhki-konigin"><div class="tagText">угольный фильтр для вытяжки konigin</div></a><a class="tag" href="https://konigin-torg.ru/t/konigin-herbarium"><div class="tagText">konigin herbarium</div></a></div></article></section><section data-no-hydrate="true"><article class="our-project-style__StyledOurProject-sc-e545f5a6-0 pFOmo"><div class="our-project-style__OurProjectLink-sc-e545f5a6-1 glfcza"><a href="https://tw-expert.ru">tw-expert.ru</a></div><div class="our-project-style__OurProjectTags-sc-e545f5a6-2 ldtvaL"><a class="tag" href="https://tw-expert.ru/t/mi-tw-earphones-2-basic"><div class="tagText">mi tw earphones 2 basic</div></a><a class="tag" href="https://tw-expert.ru/t/yamaha-tw-200"><div class="tagText">yamaha tw 200</div></a><a class="tag" href="https://tw-expert.ru/t/nike-air-max-tw"><div class="tagText">nike air max tw</div></a><a class="tag" href="https://tw-expert.ru/t/besprovodnie-naushniki-gal-tw-3500-green"><div class="tagText">беспроводные наушники gal tw 3500 green</div></a><a class="tag" href="https://tw-expert.ru/t/yamaha-tw-225"><div class="tagText">yamaha tw 225</div></a></div></article></section></div></div></div></section><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><section class="videos-style__StyledMainVideos-sc-1d67c147-1 kItBOm videos__MainVideos-sc-3cd949c1-0 fWicqx"><h2 class="block-title-style__Title-sc-2857f62c-1 fbLTvi block-title__BlockTitle-sc-1541926b-0 bMsogL">Видео<!-- --> </h2><div class="videos-style__MainVideosEmbeded-sc-1d67c147-2 hXHXCt"><iframe src="https://www.youtube.com/embed/-5_W-YtyLzY" title="Ротационная система DGM для нанесения шрифта Брайля на картонную упаковку." frameBorder="0" allow="accelerometer; autoplay; clipboard-write; encrypted-media; gyroscope; picture-in-picture" allowfullscreen=""></iframe></div><div class="videos-style__MainVideosContent-sc-1d67c147-0 iuWAyz"><div class="grid__Grid-sc-964b01b5-0 jlANNw"><article class="video-style__StyledMainVideo-sc-d584cd7d-3 beSnay video__MainVideo-sc-17215f28-0 haterf"><div class="hidden" itemscope="" itemType="http://schema.org/VideoObject"><a itemProp="url" href="https://www.youtube.com/watch?v=-DuAqUpuQ9U"><span itemProp="name">GAC GS8 – КЛАССИЧЕСКИЙ полноприводный КРОССОВЕР / НЕДОСТАТКИ тоже ЕСТЬ</span></a><p itemProp="description">GAC GS8 – КЛАССИЧЕСКИЙ полноприводный КРОССОВЕР / НЕДОСТАТКИ тоже ЕСТЬ</p><span itemProp="duration">PT6M58S</span><span itemProp="isFamilyFriendly">true</span><meta itemProp="thumbnailUrl" content="https://dgm-online.ru/thumbs/aa/a9/6d/ce/26e8b492.png"/><span itemProp="uploadDate">0001-01-01 00:00:00 +0000 UTC</span><span itemProp="thumbnail" itemscope="" itemType="http://schema.org/ImageObject"><img itemProp="contentUrl" src="https://dgm-online.ru/thumbs/aa/a9/6d/ce/26e8b492.png"/></span></div><div class="video-style__MainVideoImage-sc-d584cd7d-1 ejISWo"><img src="https://static.dgm-online.ru/pC_DFR86fKVWxAwACQ7jr5hkKSR_jwjt5TL9cNWygeY/f:webp/czM6Ly90aHVtYnMvYWEvYTkvNmQvY2UvMjZlOGI0OTIucG5n" alt="GAC GS8 – КЛАССИЧЕСКИЙ полноприводный КРОССОВЕР / НЕДОСТАТКИ тоже ЕСТЬ" title="GAC GS8 – КЛАССИЧЕСКИЙ полноприводный КРОССОВЕР / НЕДОСТАТКИ тоже ЕСТЬ"/><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG circle video-style__MainVideoPlayButton-sc-d584cd7d-0 jDilgq" style="width:50px;height:50px" aria-label="Воспроизвести"><svg width="13" height="10.5" viewBox="0 0 11 12" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M10.2935 5.19891C10.9022 5.55495 10.9022 6.44505 10.2935 6.80109L1.61957 11.8747C1.01087 12.2307 0.25 11.7857 0.25 11.0736L0.250001 0.926404C0.250001 0.21432 1.01087 -0.230733 1.61957 0.125309L10.2935 5.19891Z" fill="white"></path></svg></button></div><a href="https://www.youtube.com/embed/-DuAqUpuQ9U" class="video-style__MainVideoText-sc-d584cd7d-2 ggeYpB">GAC GS8 – КЛАССИЧЕСКИЙ полноприводный КРОССОВЕР / НЕДОСТАТКИ тоже ЕСТЬ</a></article><article class="video-style__StyledMainVideo-sc-d584cd7d-3 beSnay video__MainVideo-sc-17215f28-0 haterf"><div class="hidden" itemscope="" itemType="http://schema.org/VideoObject"><a itemProp="url" href="https://www.youtube.com/watch?v=-JCCa20YTzo"><span itemProp="name">DGM T-Folder 2000 carton pasting machine</span></a><p itemProp="description">DGM T-Folder 2000 carton pasting machine</p><span itemProp="duration">PT6M58S</span><span itemProp="isFamilyFriendly">true</span><meta itemProp="thumbnailUrl" content="https://dgm-online.ru/thumbs/eb/37/e2/c1/c1819dc6.png"/><span itemProp="uploadDate">0001-01-01 00:00:00 +0000 UTC</span><span itemProp="thumbnail" itemscope="" itemType="http://schema.org/ImageObject"><img itemProp="contentUrl" src="https://dgm-online.ru/thumbs/eb/37/e2/c1/c1819dc6.png"/></span></div><div class="video-style__MainVideoImage-sc-d584cd7d-1 ejISWo"><img src="https://static.dgm-online.ru/BwvqYvTKIF71m5P4uIqkOVQf9ZCvoPUicbnN3L0Yp4U/f:webp/czM6Ly90aHVtYnMvZWIvMzcvZTIvYzEvYzE4MTlkYzYucG5n" alt="DGM T-Folder 2000 carton pasting machine" title="DGM T-Folder 2000 carton pasting machine"/><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG circle video-style__MainVideoPlayButton-sc-d584cd7d-0 jDilgq" style="width:50px;height:50px" aria-label="Воспроизвести"><svg width="13" height="10.5" viewBox="0 0 11 12" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M10.2935 5.19891C10.9022 5.55495 10.9022 6.44505 10.2935 6.80109L1.61957 11.8747C1.01087 12.2307 0.25 11.7857 0.25 11.0736L0.250001 0.926404C0.250001 0.21432 1.01087 -0.230733 1.61957 0.125309L10.2935 5.19891Z" fill="white"></path></svg></button></div><a href="https://www.youtube.com/embed/-JCCa20YTzo" class="video-style__MainVideoText-sc-d584cd7d-2 ggeYpB">DGM T-Folder 2000 carton pasting machine</a></article><article class="video-style__StyledMainVideo-sc-d584cd7d-3 beSnay video__MainVideo-sc-17215f28-0 haterf"><div class="hidden" itemscope="" itemType="http://schema.org/VideoObject"><a itemProp="url" href="https://www.youtube.com/watch?v=-_F-dnhjAM0"><span itemProp="name">Уценка. Бензиновый опрыскиватель TCH ZZ-999</span></a><p itemProp="description">Уценка. Бензиновый опрыскиватель TCH ZZ-999</p><span itemProp="duration">PT6M58S</span><span itemProp="isFamilyFriendly">true</span><meta itemProp="thumbnailUrl" content="https://dgm-online.ru/thumbs/9b/99/74/cc/3133cc33.png"/><span itemProp="uploadDate">0001-01-01 00:00:00 +0000 UTC</span><span itemProp="thumbnail" itemscope="" itemType="http://schema.org/ImageObject"><img itemProp="contentUrl" src="https://dgm-online.ru/thumbs/9b/99/74/cc/3133cc33.png"/></span></div><div class="video-style__MainVideoImage-sc-d584cd7d-1 ejISWo"><img src="https://static.dgm-online.ru/yZm1ySEk5EtcaGApq2pwHNKei00-JnKwG94Rddc13e0/f:webp/czM6Ly90aHVtYnMvOWIvOTkvNzQvY2MvMzEzM2NjMzMucG5n" alt="Уценка. Бензиновый опрыскиватель TCH ZZ-999" title="Уценка. Бензиновый опрыскиватель TCH ZZ-999"/><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG circle video-style__MainVideoPlayButton-sc-d584cd7d-0 jDilgq" style="width:50px;height:50px" aria-label="Воспроизвести"><svg width="13" height="10.5" viewBox="0 0 11 12" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M10.2935 5.19891C10.9022 5.55495 10.9022 6.44505 10.2935 6.80109L1.61957 11.8747C1.01087 12.2307 0.25 11.7857 0.25 11.0736L0.250001 0.926404C0.250001 0.21432 1.01087 -0.230733 1.61957 0.125309L10.2935 5.19891Z" fill="white"></path></svg></button></div><a href="https://www.youtube.com/embed/-_F-dnhjAM0" class="video-style__MainVideoText-sc-d584cd7d-2 ggeYpB">Уценка. Бензиновый опрыскиватель TCH ZZ-999</a></article><article class="video-style__StyledMainVideo-sc-d584cd7d-3 beSnay video__MainVideo-sc-17215f28-0 haterf"><div class="hidden" itemscope="" itemType="http://schema.org/VideoObject"><a itemProp="url" href="https://www.youtube.com/watch?v=-llWNwE9KZY"><span itemProp="name">НАТУРАЛЬНЫЕ КАМНИ. Обзор нитей 19.07.24. Заказ в телеграмм или ватцапп 89111602266</span></a><p itemProp="description">НАТУРАЛЬНЫЕ КАМНИ. Обзор нитей 19.07.24. Заказ в телеграмм или ватцапп 89111602266</p><span itemProp="duration">PT6M58S</span><span itemProp="isFamilyFriendly">true</span><meta itemProp="thumbnailUrl" content="https://dgm-online.ru/thumbs/a7/1f/c8/2f/54b14a3a.png"/><span itemProp="uploadDate">0001-01-01 00:00:00 +0000 UTC</span><span itemProp="thumbnail" itemscope="" itemType="http://schema.org/ImageObject"><img itemProp="contentUrl" src="https://dgm-online.ru/thumbs/a7/1f/c8/2f/54b14a3a.png"/></span></div><div class="video-style__MainVideoImage-sc-d584cd7d-1 ejISWo"><img src="https://static.dgm-online.ru/idAlQfzOfSRYBlJIk1YsNMiST2IDMrEk7wnPw8RwqL4/f:webp/czM6Ly90aHVtYnMvYTcvMWYvYzgvMmYvNTRiMTRhM2EucG5n" alt="НАТУРАЛЬНЫЕ КАМНИ. Обзор нитей 19.07.24. Заказ в телеграмм или ватцапп 89111602266" title="НАТУРАЛЬНЫЕ КАМНИ. Обзор нитей 19.07.24. Заказ в телеграмм или ватцапп 89111602266"/><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG circle video-style__MainVideoPlayButton-sc-d584cd7d-0 jDilgq" style="width:50px;height:50px" aria-label="Воспроизвести"><svg width="13" height="10.5" viewBox="0 0 11 12" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M10.2935 5.19891C10.9022 5.55495 10.9022 6.44505 10.2935 6.80109L1.61957 11.8747C1.01087 12.2307 0.25 11.7857 0.25 11.0736L0.250001 0.926404C0.250001 0.21432 1.01087 -0.230733 1.61957 0.125309L10.2935 5.19891Z" fill="white"></path></svg></button></div><a href="https://www.youtube.com/embed/-llWNwE9KZY" class="video-style__MainVideoText-sc-d584cd7d-2 ggeYpB">НАТУРАЛЬНЫЕ КАМНИ. Обзор нитей 19.07.24. Заказ в телеграмм или ватцапп 89111602266</a></article><article class="video-style__StyledMainVideo-sc-d584cd7d-3 beSnay video__MainVideo-sc-17215f28-0 haterf"><div class="hidden" itemscope="" itemType="http://schema.org/VideoObject"><a itemProp="url" href="https://www.youtube.com/watch?v=-uChxi2y0is"><span itemProp="name">Недорогая защитная сварочная маска DGM V4000.Основные вопросы за 5 минут.</span></a><p itemProp="description">Недорогая защитная сварочная маска DGM V4000.Основные вопросы за 5 минут.</p><span itemProp="duration">PT6M58S</span><span itemProp="isFamilyFriendly">true</span><meta itemProp="thumbnailUrl" content="https://dgm-online.ru/thumbs/cf/56/c8/47/847e6338.png"/><span itemProp="uploadDate">0001-01-01 00:00:00 +0000 UTC</span><span itemProp="thumbnail" itemscope="" itemType="http://schema.org/ImageObject"><img itemProp="contentUrl" src="https://dgm-online.ru/thumbs/cf/56/c8/47/847e6338.png"/></span></div><div class="video-style__MainVideoImage-sc-d584cd7d-1 ejISWo"><img src="https://static.dgm-online.ru/P-Wcxy8r6X0OeNAECSTdaq9TAY8QzFB-tKr4WrAh9Js/f:webp/czM6Ly90aHVtYnMvY2YvNTYvYzgvNDcvODQ3ZTYzMzgucG5n" alt="Недорогая защитная сварочная маска DGM V4000.Основные вопросы за 5 минут." title="Недорогая защитная сварочная маска DGM V4000.Основные вопросы за 5 минут."/><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG circle video-style__MainVideoPlayButton-sc-d584cd7d-0 jDilgq" style="width:50px;height:50px" aria-label="Воспроизвести"><svg width="13" height="10.5" viewBox="0 0 11 12" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M10.2935 5.19891C10.9022 5.55495 10.9022 6.44505 10.2935 6.80109L1.61957 11.8747C1.01087 12.2307 0.25 11.7857 0.25 11.0736L0.250001 0.926404C0.250001 0.21432 1.01087 -0.230733 1.61957 0.125309L10.2935 5.19891Z" fill="white"></path></svg></button></div><a href="https://www.youtube.com/embed/-uChxi2y0is" class="video-style__MainVideoText-sc-d584cd7d-2 ggeYpB">Недорогая защитная сварочная маска DGM V4000.Основные вопросы за 5 минут.</a></article><article class="video-style__StyledMainVideo-sc-d584cd7d-3 beSnay video__MainVideo-sc-17215f28-0 haterf"><div class="hidden" itemscope="" itemType="http://schema.org/VideoObject"><a itemProp="url" href="https://www.youtube.com/watch?v=-yOIyGkxE3w"><span itemProp="name">DGM - &quot;Ghost of Insanity&quot; feat. Tom Englund of Evergrey (Official Lyric Video)</span></a><p itemProp="description">DGM - &quot;Ghost of Insanity&quot; feat. Tom Englund of Evergrey (Official Lyric Video)</p><span itemProp="duration">PT6M58S</span><span itemProp="isFamilyFriendly">true</span><meta itemProp="thumbnailUrl" content="https://dgm-online.ru/thumbs/97/d3/5a/2c/34b142cf.png"/><span itemProp="uploadDate">0001-01-01 00:00:00 +0000 UTC</span><span itemProp="thumbnail" itemscope="" itemType="http://schema.org/ImageObject"><img itemProp="contentUrl" src="https://dgm-online.ru/thumbs/97/d3/5a/2c/34b142cf.png"/></span></div><div class="video-style__MainVideoImage-sc-d584cd7d-1 ejISWo"><img src="https://static.dgm-online.ru/ruq_jXZB_mTTA6OcCp5qIKvdCq9N9AzwopBTdTwVNZA/f:webp/czM6Ly90aHVtYnMvOTcvZDMvNWEvMmMvMzRiMTQyY2YucG5n" alt="DGM - &quot;Ghost of Insanity&quot; feat. Tom Englund of Evergrey (Official Lyric Video)" title="DGM - &quot;Ghost of Insanity&quot; feat. Tom Englund of Evergrey (Official Lyric Video)"/><button type="button" class="icon-button-style__Button-sc-4db2e416-0 OyqUG circle video-style__MainVideoPlayButton-sc-d584cd7d-0 jDilgq" style="width:50px;height:50px" aria-label="Воспроизвести"><svg width="13" height="10.5" viewBox="0 0 11 12" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M10.2935 5.19891C10.9022 5.55495 10.9022 6.44505 10.2935 6.80109L1.61957 11.8747C1.01087 12.2307 0.25 11.7857 0.25 11.0736L0.250001 0.926404C0.250001 0.21432 1.01087 -0.230733 1.61957 0.125309L10.2935 5.19891Z" fill="white"></path></svg></button></div><a href="https://www.youtube.com/embed/-yOIyGkxE3w" class="video-style__MainVideoText-sc-d584cd7d-2 ggeYpB">DGM - &quot;Ghost of Insanity&quot; feat. Tom Englund of Evergrey (Official Lyric Video)</a></article></div><a class="show-more-button-style__StyledShowMoreButton-sc-e7dcca96-0 gbMoUx show-more-button__ShowMoreButton-sc-a94f7924-0 hBQmQK" href="#">Показать ещё</a></div></section><section class="common-block-with-title__StyledCommonBlock-sc-fe9ea2ff-0 hvIkig"></section><section class="common-block-with-title__StyledCommonBlock-sc-fe9ea2ff-0 hvIkig"><div class="faq-style__StyledFaq-sc-d56e7776-2 kZicxT faq__FAQ-sc-2bccedb9-0 wVlnq"><h2 class="block-title-style__Title-sc-2857f62c-1 fbLTvi block-title__BlockTitle-sc-1541926b-0 bMsogL">Часто спрашивают<!-- --> </h2><div class="faq-style__FaqItems-sc-d56e7776-1 fJKbOZ"><a href="/q/dgm-plus-chto-plus-eto-plus-v-logistike" class="faq-style__FaqItem-sc-d56e7776-0 leJrty">DGM что это в логистике<!-- -->?</a><a href="/q/dgm-report-plus-chto-plus-eto-plus-v-logistike" class="faq-style__FaqItem-sc-d56e7776-0 leJrty">DGM report что это в логистике<!-- -->?</a><a href="/q/dgm-test-report-plus-chto-plus-eto" class="faq-style__FaqItem-sc-d56e7776-0 leJrty">DGM test report что это<!-- -->?</a><a href="/q/netbios-dgm-plus-chto-plus-eto" class="faq-style__FaqItem-sc-d56e7776-0 leJrty">Netbios DGM что это<!-- -->?</a><a href="/q/sertifikat-dgm-kitay-plus-chto-plus-eto" class="faq-style__FaqItem-sc-d56e7776-0 leJrty">Сертификат DGM китай что это<!-- -->?</a></div></div></section><section class="tags-block-style__StyledTagsBlock-sc-465ab32d-1 gXUAbK"><h2 class="block-title-style__Title-sc-2857f62c-1 fbLTvi block-title__BlockTitle-sc-1541926b-0 bMsogL">Смотрите также<!-- --> </h2><div class="tags-block-style__TagsList-sc-465ab32d-0 dAQdzv"><a class="tag" href="/t/kompressor-dgm"><div class="tagText">компрессор dgm</div></a><a class="tag" href="/t/dgm-ac"><div class="tagText">dgm ac</div></a><a class="tag" href="/t/dgm-instrument"><div class="tagText">dgm инструмент</div></a><a class="tag" href="/t/dgm-zapchasti"><div class="tagText">dgm запчасти</div></a><a class="tag" href="/t/dgm-400"><div class="tagText">dgm 400</div></a><a class="tag" href="/t/dgm-1500"><div class="tagText">dgm 1500</div></a><a class="tag" href="/t/plazmennie-sterilizatori-dgm"><div class="tagText">плазменные стерилизаторы dgm</div></a><a class="tag" href="/t/dgm-200"><div class="tagText">dgm 200</div></a><a class="tag" href="/t/nasos-sadoviy-dgm-05d"><div class="tagText">насос садовый dgm 05d</div></a><a class="tag" href="/t/dgm-1200"><div class="tagText">dgm 1200</div></a><button class="dropdown-button-style__StyledButton-sc-3cc38e98-0 cRfzTh">Показать ещё<!-- --> <div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="17" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.49997 9.44498L12.9087 5.03625L14.1681 6.29563L8.49997 11.9638L2.83186 6.29563L4.09124 5.03625L8.49997 9.44498Z" fill="#302E30"></path></svg></div></button></div></section><section data-no-hydrate="true"><section data-no-hydrate="true"><section class="tags-block-style__StyledTagsBlock-sc-d18f27a5-1 gKLNbb"><h2 class="block-title-style__Title-sc-2857f62c-1 fbLTvi block-title__BlockTitle-sc-1541926b-0 bMsogL">Города<!-- --> </h2><div class="tags-block-style__TagsList-sc-d18f27a5-0 klXuck citiesList"><a class='tag' href='https://miass.dgm-online.ru/'><div class='tagText'>Миасс</div></a><a class='tag' href='https://mineralnye-vody.dgm-online.ru/'><div class='tagText'>Минеральные Воды</div></a><a class='tag' href='https://minusinsk.dgm-online.ru/'><div class='tagText'>Минусинск</div></a><a class='tag' href='https://mihaylovka.dgm-online.ru/'><div class='tagText'>Михайловка</div></a><a class='tag' href='https://mihaylovsk.dgm-online.ru/'><div class='tagText'>Михайловск</div></a><a class='tag' href='https://michurinsk.dgm-online.ru/'><div class='tagText'>Мичуринск</div></a><a class='tag' href='https://monchegorsk.dgm-online.ru/'><div class='tagText'>Мончегорск</div></a><a class='tag' href='https://murmansk.dgm-online.ru/'><div class='tagText'>Мурманск</div></a><a class='tag' href='https://murom.dgm-online.ru/'><div class='tagText'>Муром</div></a><a class='tag' href='https://mytishhi.dgm-online.ru/'><div class='tagText'>Мытищи</div></a><a class='tag' href='https://naberezhnye-chelny.dgm-online.ru/'><div class='tagText'>Набережные Челны</div></a><a class='tag' href='https://nazarovo.dgm-online.ru/'><div class='tagText'>Назарово</div></a><a class='tag' href='https://nazran.dgm-online.ru/'><div class='tagText'>Назрань</div></a><a class='tag' href='https://nalchik.dgm-online.ru/'><div class='tagText'>Нальчик</div></a></div></section></section></section></div></div><div class="tap-bar-style__StyledTapBar-sc-b7c948cf-0 gvOvZw"><a href="#" class="tap-bar-style__TapBarItem-sc-b7c948cf-4 hhKyke"><div class="tap-bar-style__TapBarItemIcon-sc-b7c948cf-1 jaJEkZ"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="27" height="17" viewBox="0 0 27 17" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M17.4708 13.0736C18.2066 13.0736 18.9352 12.9287 19.6149 12.6471C20.2947 12.3655 20.9123 11.9528 21.4326 11.4326C21.9529 10.9123 22.3656 10.2947 22.6471 9.61491C22.9287 8.93515 23.0736 8.20659 23.0736 7.47083C23.0736 6.73506 22.9287 6.0065 22.6471 5.32674C22.3656 4.64698 21.9529 4.02934 21.4326 3.50907C20.9123 2.98881 20.2947 2.57611 19.6149 2.29454C18.9352 2.01298 18.2066 1.86806 17.4708 1.86806C15.9849 1.86806 14.5598 2.45835 13.5091 3.50907C12.4584 4.55979 11.8681 5.98488 11.8681 7.47083C11.8681 8.95677 12.4584 10.3819 13.5091 11.4326C14.5598 12.4833 15.9849 13.0736 17.4708 13.0736ZM23.3724 12.052L26.7154 15.395C26.8045 15.4812 26.8756 15.5843 26.9245 15.6983C26.9733 15.8122 26.999 15.9348 27 16.0588C27.001 16.1827 26.9772 16.3057 26.9302 16.4204C26.8832 16.5351 26.8138 16.6394 26.726 16.727C26.6383 16.8146 26.534 16.8838 26.4192 16.9307C26.3044 16.9776 26.1814 17.0011 26.0574 17C25.9334 16.9988 25.8109 16.9729 25.697 16.9239C25.5832 16.8749 25.4802 16.8037 25.3941 16.7145L22.0511 13.3715C20.55 14.5367 18.6612 15.0861 16.7693 14.9077C14.8774 14.7294 13.1246 13.8368 11.8676 12.4116C10.6107 10.9864 9.94415 9.13573 10.0037 7.23637C10.0632 5.33701 10.8443 3.53173 12.188 2.18802C13.5317 0.844311 15.337 0.06319 17.2364 0.00366889C19.1357 -0.0558522 20.9864 0.610702 22.4116 1.86764C23.8368 3.12458 24.7294 4.87741 24.9078 6.76932C25.0861 8.66122 24.5367 10.55 23.3715 12.0511L23.3724 12.052Z" fill="#302E30"></path><rect width="10" height="2" fill="#302E30"></rect><rect y="7" width="6" height="2" fill="#302E30"></rect><rect y="14" width="10" height="2" fill="#302E30"></rect></svg></div></div><div class="tap-bar-style__TapBarItemText-sc-b7c948cf-3 ksGZja">Каталог</div></a><a href="/favorites" class="tap-bar-style__TapBarItem-sc-b7c948cf-4 hhKyke"><div class="tap-bar-style__TapBarItemIcon-sc-b7c948cf-1 jaJEkZ"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><div class="icon-heart__StyledIconHeart-sc-6dcbbacc-0 cOwaEK"><svg width="30" height="30" viewBox="0 0 30 30" fill="none" xmlns="http://www.w3.org/2000/svg"><path fill-rule="evenodd" clip-rule="evenodd" d="M23.4787 15.7714L14.9988 24.5L6.52098 15.7714C6.49542 15.742 6.47019 15.7124 6.44528 15.6826C6.44224 15.679 6.43921 15.6753 6.43617 15.6717C4.43131 13.2628 4.52565 9.6417 6.71826 7.3461C6.73109 7.33267 6.744 7.31928 6.75697 7.30593C6.77531 7.28709 6.79373 7.2684 6.81224 7.24986C7.97843 6.08168 9.49227 5.4984 11.0056 5.5C12.2897 5.50137 13.5735 5.92387 14.6442 6.76751C14.6443 6.76761 14.6445 6.7677 14.6446 6.7678C14.6461 6.769 14.6476 6.77019 14.6491 6.77139C14.7691 6.86616 14.8865 6.96622 15.0008 7.07158C15.1146 6.96654 15.2315 6.86675 15.351 6.77223C15.3512 6.7721 15.3513 6.77197 15.3515 6.77184C15.3526 6.77097 15.3537 6.7701 15.3548 6.76923C16.423 5.92599 17.7068 5.50244 18.9916 5.50009C20.5301 5.49728 22.0699 6.09837 23.2427 7.30593C25.5046 9.63712 25.5826 13.3498 23.4787 15.7714ZM21.8267 8.7583C23.3169 10.2932 23.3935 12.7377 22.0244 14.3586C22.0229 14.3605 22.0213 14.3624 22.0197 14.3643L14.9998 21.5901L7.97995 14.3632C7.97863 14.3617 7.97731 14.3601 7.97599 14.3586C7.97594 14.3585 7.97588 14.3584 7.97582 14.3584C6.60713 12.7384 6.68347 10.2903 8.17195 8.76036C8.18416 8.7478 8.19701 8.73477 8.2094 8.72236C8.21008 8.72167 8.21076 8.72099 8.21143 8.72032C9.70479 7.22657 12.0631 7.16434 13.6249 8.56484C13.6284 8.56801 13.632 8.57118 13.6355 8.57436C13.6456 8.58354 13.6558 8.59277 13.6658 8.60207L15.0018 9.83242L16.3368 8.60104C16.3448 8.59365 16.3528 8.5863 16.3609 8.57899C16.3665 8.57387 16.3722 8.56877 16.3778 8.56368C16.4631 8.48711 16.5508 8.41492 16.6406 8.3471C18.191 7.17644 20.3799 7.30895 21.7878 8.71882C21.8008 8.73187 21.8138 8.74503 21.8267 8.7583Z" fill="#9CA0A9"></path></svg></div></div></div><div class="tap-bar-style__TapBarItemText-sc-b7c948cf-3 ksGZja">Избранное</div></a><a href="/cart" class="tap-bar-style__TapBarItem-sc-b7c948cf-4 hhKyke"><div class="tap-bar-style__TapBarItemIcon-sc-b7c948cf-1 jaJEkZ"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="30" height="30" viewBox="0 0 30 30" fill="none" xmlns="http://www.w3.org/2000/svg"><path fill-rule="evenodd" clip-rule="evenodd" d="M4 4H6.79729C7.77422 4 8.62579 4.66489 8.86273 5.61265L9.67615 8.86632H24.1983C25.3742 8.86632 26.3274 9.81951 26.3274 10.9953V15.1775C26.3274 16.1145 25.7147 16.9414 24.8182 17.2142L12.7154 20.8977C11.539 21.2557 10.3048 20.5455 10.0231 19.3485L7.85833 10.1481L6.85025 6.11577C6.84417 6.09147 6.82233 6.07442 6.79729 6.07442H4V4ZM10.1759 10.9407L12.0424 18.8734C12.0496 18.9041 12.0813 18.9223 12.1115 18.9131L24.2142 15.2297C24.2372 15.2227 24.2529 15.2015 24.2529 15.1775V10.9953C24.2529 10.9652 24.2285 10.9407 24.1983 10.9407H10.1759Z" fill="#E64E8D"></path><path d="M12.1883 24.0348C12.1883 25.1202 11.3084 26.0001 10.2231 26.0001C9.13768 26.0001 8.25781 25.1202 8.25781 24.0348C8.25781 22.9494 9.13768 22.0696 10.2231 22.0696C11.3084 22.0696 12.1883 22.9494 12.1883 24.0348Z" fill="#E64E8D"></path><path d="M24.3543 24.0348C24.3543 25.1202 23.4744 26.0001 22.3891 26.0001C21.3037 26.0001 20.4238 25.1202 20.4238 24.0348C20.4238 22.9494 21.3037 22.0696 22.3891 22.0696C23.4744 22.0696 24.3543 22.9494 24.3543 24.0348Z" fill="#E64E8D"></path></svg></div></div><div class="tap-bar-style__TapBarItemText-sc-b7c948cf-3 ksGZja">Корзина</div></a><a href="#" class="tap-bar-style__TapBarItem-sc-b7c948cf-4 hhKyke"><div class="tap-bar-style__TapBarItemIcon-sc-b7c948cf-1 jaJEkZ"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="30" height="30" viewBox="0 0 30 30" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M24.7056 23.4216C22.4396 21.5162 18.9337 20.2939 14.9997 20.2939C11.0653 20.2939 7.56009 21.5156 5.29432 23.4211C4.76788 23.8638 4.98288 24.5808 5.65942 24.8474L5.80393 24.9044C6.29099 25.0963 6.86666 24.9859 7.2594 24.6789C9.07313 23.2611 11.8666 22.3523 14.9997 22.3523C18.1331 22.3523 20.9267 23.2613 22.7404 24.6793C23.1329 24.9861 23.7082 25.0966 24.1951 24.905L24.3399 24.8481C25.017 24.5817 25.2323 23.8645 24.7056 23.4216Z" fill="currentColor"></path><path fill-rule="evenodd" clip-rule="evenodd" d="M15 15.4565C17.2013 15.4565 18.9859 13.6719 18.9859 11.4706C18.9859 9.26924 17.2013 7.4847 15 7.4847C12.7987 7.4847 11.0141 9.26924 11.0141 11.4706C11.0141 13.6719 12.7987 15.4565 15 15.4565ZM15 17.9412C18.5736 17.9412 21.4706 15.0442 21.4706 11.4706C21.4706 7.89698 18.5736 5 15 5C11.4264 5 8.52942 7.89698 8.52942 11.4706C8.52942 15.0442 11.4264 17.9412 15 17.9412Z" fill="currentColor"></path></svg></div></div><div class="tap-bar-style__TapBarItemText-sc-b7c948cf-3 ksGZja">Вход</div></a></div><footer class="footer-style__StyledFooter-sc-5e53f7f6-30 dLSTHR"><div class="footer-style__FooterTop-sc-5e53f7f6-0 chkWLl"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="footer-style__FooterTopContent-sc-5e53f7f6-29 cKeGOT"><div class="footer-style__FooterTopContentFlex-sc-5e53f7f6-28 bvJIBl"><div class="footer-style__LogoBlock-sc-5e53f7f6-3 hbAPAo"><div class="footer-style__Logo-sc-5e53f7f6-4 fikKbJ">do</div><div class="footer-style__LogoMarketNameBlock-sc-5e53f7f6-5 iiOmsY"><div font-size="24" class="footer-style__LogoMarketName-sc-5e53f7f6-9 gsGLlq">DGM</div><div class="footer-style__LogoMarketSubname-sc-5e53f7f6-6 dNSWIw">online</div></div><div class="footer-style__LogoDivider-sc-5e53f7f6-7 ksPSfO"></div><div class="footer-style__LogoMarketDescription-sc-5e53f7f6-8 bXexqT">специализированный маркетплейс</div></div><nav class="footer-style__FooterNav-sc-5e53f7f6-10 cFhTCh"><a href="/about">О сервисе</a><a href="/contacts">Контакты</a><a href="/info/guide">Как это работает</a><a href="/info/customers">Покупателям</a><a href="/info/vacancies">Вакансии</a><a href="/info/delivery">Оплата и доставка</a><a href="/feedback">Обратная связь</a><a href="/info/garanties">Гарантия и возвраты</a></nav><div class="footer-style__FooterSocials-sc-5e53f7f6-16 itNWsU"><div class="footer-style__FooterBlock-sc-5e53f7f6-11 iJvUNo"><div class="footer-style__FooterBlockTitle-sc-5e53f7f6-12 eHHvPv">Присоединяйтесь к нам</div><div class="footer-style__FooterBlockContent-sc-5e53f7f6-13 jytBMj"><div class="footer-style__FooterBlockSocialsContent-sc-5e53f7f6-14 kyDkYk"><div class="footer-style__FooterSocial-sc-5e53f7f6-15 fOytEd vk"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="19" height="10" viewBox="0 0 19 10" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M10.3631 9.9149C10.3631 9.9149 10.6808 9.88026 10.8435 9.70873C10.9924 9.55157 10.9872 9.25498 10.9872 9.25498C10.9872 9.25498 10.9674 7.87007 11.6225 7.66558C12.2681 7.46448 13.0971 9.00487 13.9768 9.59719C14.6414 10.045 15.1458 9.94701 15.1458 9.94701L17.4967 9.9149C17.4967 9.9149 18.726 9.84055 18.1432 8.89164C18.095 8.8139 17.8032 8.18947 16.3957 6.90679C14.9212 5.56413 15.1192 5.78129 16.8942 3.45845C17.9753 2.04396 18.4075 1.1804 18.2723 0.811146C18.1441 0.457946 17.3487 0.551738 17.3487 0.551738L14.7025 0.567793C14.7025 0.567793 14.5062 0.541599 14.3608 0.626941C14.2187 0.710594 14.1266 0.905783 14.1266 0.905783C14.1266 0.905783 13.7083 2.00003 13.1496 2.93119C11.9711 4.89491 11.5003 4.99884 11.3075 4.87716C10.859 4.59241 10.9709 3.73476 10.9709 3.12553C10.9709 1.2218 11.2653 0.428372 10.3984 0.223043C10.1109 0.1546 9.89916 0.109817 9.16316 0.102212C8.21885 0.0929171 7.42001 0.105592 6.96722 0.32275C6.66593 0.467241 6.43351 0.790021 6.57555 0.808611C6.75029 0.831425 7.14627 0.913388 7.35631 1.19392C7.62746 1.55641 7.618 2.36928 7.618 2.36928C7.618 2.36928 7.7738 4.61015 7.25387 4.88815C6.89749 5.07911 6.40855 4.68958 5.35749 2.90753C4.81948 1.99496 4.41318 0.986055 4.41318 0.986055C4.41318 0.986055 4.33484 0.797626 4.19453 0.696229C4.02495 0.573708 3.78822 0.535684 3.78822 0.535684L1.27378 0.551738C1.27378 0.551738 0.895881 0.561878 0.75729 0.723268C0.634193 0.866069 0.747821 1.16266 0.747821 1.16266C0.747821 1.16266 2.71651 5.68412 4.94602 7.96301C6.99046 10.0518 9.31122 9.9149 9.31122 9.9149H10.3631Z" fill="currentColor"></path></svg></div></div><div class="footer-style__FooterSocial-sc-5e53f7f6-15 fOytEd facebook"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="10" height="19" viewBox="0 0 10 19" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M6.21981 18.2016V9.22477H8.69782L9.02621 6.13129H6.21981L6.22402 4.58297C6.22402 3.77615 6.30068 3.34383 7.45952 3.34383H9.00867V0.25H6.53031C3.5534 0.25 2.50561 1.75067 2.50561 4.27433V6.13164H0.649994V9.22512H2.50561V18.2016H6.21981Z" fill="currentColor"></path></svg></div></div><div class="footer-style__FooterSocial-sc-5e53f7f6-15 fOytEd twitter"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="17" height="15" viewBox="0 0 17 15" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M8.26931 4.41143L8.30394 4.98237L7.72687 4.91246C5.62633 4.64447 3.79125 3.73563 2.23316 2.20924L1.47143 1.45188L1.27522 2.01116C0.859731 3.2579 1.12518 4.57455 1.99079 5.46009C2.45245 5.94946 2.34857 6.01937 1.55222 5.72808C1.27522 5.63487 1.03285 5.56496 1.00977 5.59991C0.928979 5.68147 1.20597 6.74179 1.42526 7.16125C1.72534 7.74384 2.33703 8.31477 3.00643 8.65268L3.57196 8.92067L2.90256 8.93232C2.25624 8.93232 2.23316 8.94397 2.30241 9.18866C2.53324 9.94602 3.44501 10.75 4.46065 11.0995L5.17622 11.3442L4.55298 11.7171C3.62967 12.2531 2.54478 12.556 1.45988 12.5793C0.940521 12.591 0.513489 12.6376 0.513489 12.6725C0.513489 12.7891 1.92154 13.4416 2.74098 13.6979C5.1993 14.4553 8.11928 14.129 10.3121 12.8357C11.8702 11.9152 13.4283 10.0858 14.1554 8.31477C14.5478 7.37098 14.9402 5.64652 14.9402 4.81924C14.9402 4.28326 14.9749 4.21335 15.6212 3.5725C16.0021 3.19965 16.3598 2.79183 16.4291 2.67532C16.5445 2.45393 16.533 2.45393 15.9444 2.65201C14.9633 3.00156 14.8248 2.95496 15.3096 2.43063C15.6674 2.05777 16.0944 1.38197 16.0944 1.18389C16.0944 1.14893 15.9213 1.20719 15.7251 1.31206C15.5173 1.42858 15.0557 1.60335 14.7094 1.70822L14.0862 1.9063L13.5207 1.52179C13.209 1.31206 12.7705 1.07902 12.5396 1.00911C11.951 0.845986 11.0508 0.86929 10.5199 1.05572C9.07721 1.58005 8.16544 2.93165 8.26931 4.41143Z" fill="currentColor"></path></svg></div></div><div class="footer-style__FooterSocial-sc-5e53f7f6-15 fOytEd ok"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="11" height="17" viewBox="0 0 11 17" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M7.28474 12.2402L9.75057 14.6207C10.2557 15.1073 10.2557 15.8975 9.75057 16.3846C9.24595 16.8717 8.42806 16.8717 7.92396 16.3846L5.49956 14.0454L3.07728 16.3846C2.8247 16.6279 2.49375 16.7497 2.16279 16.7497C1.83235 16.7497 1.50192 16.6279 1.24935 16.3846C0.744727 15.8975 0.744727 15.1078 1.24882 14.6207L3.71492 12.2402C2.81705 12.0427 1.95112 11.6993 1.15354 11.2163C0.549952 10.8489 0.368637 10.0793 0.74895 9.49613C1.12821 8.91222 1.92578 8.73643 2.53043 9.1038C4.33619 10.2003 6.66241 10.2006 8.46923 9.1038C9.07387 8.73643 9.87119 8.91222 10.2512 9.49613C10.6315 10.0788 10.4497 10.8489 9.84611 11.2163C9.04854 11.6998 8.18261 12.0427 7.28474 12.2402Z" fill="currentColor"></path><path fill-rule="evenodd" clip-rule="evenodd" d="M1.07788 4.50809C1.07788 6.85546 3.05625 8.7649 5.48883 8.7649C7.92194 8.7649 9.89978 6.85546 9.89978 4.50809C9.89978 2.15995 7.92194 0.25 5.48883 0.25C3.05625 0.25 1.07788 2.15995 1.07788 4.50809ZM7.31519 4.50792C7.31519 3.53575 6.49597 2.74522 5.48884 2.74522C4.4825 2.74522 3.66249 3.53575 3.66249 4.50792C3.66249 5.47933 4.4825 6.27036 5.48884 6.27036C6.49597 6.27036 7.31519 5.47933 7.31519 4.50792Z" fill="currentColor"></path></svg></div></div><div class="footer-style__FooterSocial-sc-5e53f7f6-15 fOytEd youtube"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="19" height="14" viewBox="0 0 19 14" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M17.9322 2.42517C17.7298 1.6476 17.1334 1.0353 16.3761 0.827493C15.0037 0.449829 9.49998 0.449829 9.49998 0.449829C9.49998 0.449829 3.99628 0.449829 2.62378 0.827493C1.86648 1.0353 1.27008 1.6476 1.06768 2.42517C0.699982 3.83442 0.699982 6.77483 0.699982 6.77483C0.699982 6.77483 0.699982 9.71514 1.06768 11.1245C1.27008 11.9021 1.86648 12.5144 2.62378 12.7223C3.99628 13.0998 9.49998 13.0998 9.49998 13.0998C9.49998 13.0998 15.0037 13.0998 16.3761 12.7223C17.1334 12.5144 17.7298 11.9021 17.9322 11.1245C18.3 9.71514 18.3 6.77483 18.3 6.77483C18.3 6.77483 18.3 3.83442 17.9322 2.42517Z" fill="currentColor"></path><path d="M7.85001 9.80005V4.30005L12.25 7.05015L7.85001 9.80005Z" fill="#302E30"></path></svg></div></div><div class="footer-style__FooterSocial-sc-5e53f7f6-15 fOytEd instagram"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="19" height="19" viewBox="0 0 19 19" fill="none" xmlns="http://www.w3.org/2000/svg"><path fill-rule="evenodd" clip-rule="evenodd" d="M9.50096 0.699829C7.111 0.699829 6.81107 0.710279 5.87239 0.752996C4.93555 0.795897 4.29607 0.944215 3.73653 1.16183C3.15774 1.3866 2.66677 1.68727 2.17763 2.17659C1.68813 2.66573 1.38746 3.1567 1.16196 3.73531C0.943787 4.29503 0.795285 4.93469 0.753118 5.87117C0.711134 6.80984 0.700134 7.10996 0.700134 9.49992C0.700134 11.8899 0.710768 12.1889 0.753302 13.1276C0.796385 14.0644 0.944704 14.7039 1.16214 15.2634C1.38709 15.8422 1.68776 16.3332 2.17708 16.8223C2.66604 17.3118 3.15701 17.6132 3.73543 17.838C4.29534 18.0556 4.935 18.2039 5.87165 18.2468C6.81033 18.2896 7.11008 18.3 9.49986 18.3C11.89 18.3 12.189 18.2896 13.1277 18.2468C14.0645 18.2039 14.7047 18.0556 15.2647 17.838C15.8433 17.6132 16.3335 17.3118 16.8225 16.8223C17.312 16.3332 17.6126 15.8422 17.8381 15.2636C18.0545 14.7039 18.203 14.0642 18.247 13.1278C18.2891 12.1891 18.3001 11.8899 18.3001 9.49992C18.3001 7.10996 18.2891 6.81003 18.247 5.87135C18.203 4.93451 18.0545 4.29503 17.8381 3.73549C17.6126 3.1567 17.312 2.66573 16.8225 2.17659C16.3329 1.68709 15.8434 1.38642 15.2641 1.16183C14.7031 0.944215 14.0633 0.795897 13.1264 0.752996C12.1877 0.710279 11.8889 0.699829 9.49821 0.699829H9.50096ZM8.71152 2.28549C8.8648 2.28525 9.02971 2.28533 9.20766 2.28541L9.50096 2.28549C11.8506 2.28549 12.1291 2.29393 13.0569 2.33609C13.9149 2.37533 14.3806 2.5187 14.6908 2.63915C15.1015 2.79865 15.3943 2.98932 15.7021 3.29732C16.0101 3.60532 16.2008 3.89866 16.3606 4.30933C16.4811 4.61917 16.6246 5.08484 16.6637 5.94285C16.7058 6.87053 16.715 7.1492 16.715 9.49772C16.715 11.8462 16.7058 12.1249 16.6637 13.0526C16.6244 13.9106 16.4811 14.3763 16.3606 14.6861C16.2011 15.0968 16.0101 15.3892 15.7021 15.697C15.3941 16.005 15.1017 16.1957 14.6908 16.3552C14.381 16.4762 13.9149 16.6192 13.0569 16.6584C12.1293 16.7006 11.8506 16.7098 9.50096 16.7098C7.15115 16.7098 6.87266 16.7006 5.94499 16.6584C5.08698 16.6188 4.62131 16.4755 4.31092 16.355C3.90025 16.1955 3.60691 16.0048 3.29891 15.6968C2.99091 15.3888 2.80024 15.0962 2.64037 14.6854C2.51992 14.3755 2.37637 13.9099 2.33732 13.0519C2.29515 12.1242 2.28672 11.8455 2.28672 9.49552C2.28672 7.14553 2.29515 6.86833 2.33732 5.94065C2.37655 5.08264 2.51992 4.61697 2.64037 4.30677C2.79987 3.89609 2.99091 3.60276 3.29891 3.29475C3.60691 2.98675 3.90025 2.79608 4.31092 2.63621C4.62112 2.51521 5.08698 2.37221 5.94499 2.33279C6.7568 2.29613 7.0714 2.28513 8.71152 2.28329V2.28549ZM13.1426 4.80259C13.1426 4.2194 13.6156 3.74695 14.1986 3.74695V3.74658C14.7816 3.74658 15.2546 4.21959 15.2546 4.80259C15.2546 5.3856 14.7816 5.8586 14.1986 5.8586C13.6156 5.8586 13.1426 5.3856 13.1426 4.80259ZM9.50069 4.98083C7.00503 4.98093 4.98166 7.00436 4.98166 9.50005C4.98166 11.9958 7.00513 14.0183 9.50088 14.0183C11.9966 14.0183 14.0194 11.9958 14.0194 9.50005C14.0194 7.0043 11.9964 4.98083 9.50069 4.98083ZM12.4344 9.5002C12.4344 7.88007 11.121 6.56684 9.50103 6.56684C7.8809 6.56684 6.56767 7.88007 6.56767 9.5002C6.56767 11.1201 7.8809 12.4336 9.50103 12.4336C11.121 12.4336 12.4344 11.1201 12.4344 9.5002Z" fill="currentColor"></path></svg></div></div></div></div></div></div><div class="footer-style__FooterLocation-sc-5e53f7f6-17 daYXjK"><div class="footer-style__FooterBlock-sc-5e53f7f6-11 iJvUNo"><div class="footer-style__FooterBlockTitle-sc-5e53f7f6-12 eHHvPv">Ваш город</div><div class="footer-style__FooterBlockContent-sc-5e53f7f6-13 jytBMj"><div class="location-button-style__LocationButtonContainer-sc-68155fee-0 cXIMUt"><button class="location-button-style__LocationButton-sc-68155fee-1 gCoGvW"><div class="location-button-style__LocationButtonIcon-sc-68155fee-2 hTgthp"><div class="icon__Icon-sc-bdfa49d7-0 enNgdv"><svg width="15" height="15" viewBox="0 0 15 15" fill="none" xmlns="http://www.w3.org/2000/svg"><path d="M7.5 14.83L3.5225 10.8525C2.73584 10.0658 2.20012 9.0635 1.98308 7.97236C1.76604 6.88122 1.87744 5.75022 2.30319 4.72239C2.72893 3.69456 3.4499 2.81606 4.37493 2.19798C5.29995 1.5799 6.38749 1.25 7.5 1.25C8.61252 1.25 9.70005 1.5799 10.6251 2.19798C11.5501 2.81606 12.2711 3.69456 12.6968 4.72239C13.1226 5.75022 13.234 6.88122 13.0169 7.97236C12.7999 9.0635 12.2642 10.0658 11.4775 10.8525L7.5 14.83ZM10.5938 9.9687C11.2056 9.35683 11.6222 8.57728 11.791 7.72862C11.9597 6.87997 11.8731 6.00032 11.5419 5.20092C11.2108 4.40152 10.65 3.71827 9.93058 3.23756C9.21112 2.75684 8.36528 2.50027 7.5 2.50027C6.63473 2.50027 5.78888 2.75684 5.06943 3.23756C4.34997 3.71827 3.78922 4.40152 3.45807 5.20092C3.12693 6.00032 3.04026 6.87997 3.20903 7.72862C3.37781 8.57728 3.79444 9.35683 4.40625 9.9687L7.5 13.0625L10.5938 9.9687ZM7.5 8.12495C7.16848 8.12495 6.85054 7.99325 6.61612 7.75883C6.3817 7.52441 6.25 7.20647 6.25 6.87495C6.25 6.54343 6.3817 6.22549 6.61612 5.99107C6.85054 5.75665 7.16848 5.62495 7.5 5.62495C7.83152 5.62495 8.14947 5.75665 8.38389 5.99107C8.61831 6.22549 8.75 6.54343 8.75 6.87495C8.75 7.20647 8.61831 7.52441 8.38389 7.75883C8.14947 7.99325 7.83152 8.12495 7.5 8.12495Z" fill="currentColor"></path></svg></div></div><div class="location-button-style__LocationButtonText-sc-68155fee-3 doQUOZ"><section data-no-hydrate="true">Москва</section></div></button></div></div></div></div></div><div class="footer-style__FooterTopSEO-sc-5e53f7f6-18 dNCFlh"><noindex>Dgm-online.ru<!-- --> — каталог описаний и цен на <!-- -->Пневмоинструменты, Сварочное оборудование, Оборудование для салонов красоты, Расходные материалы и оснастка<!-- -->. Наша задача — помочь подобрать и купить <!-- -->товары<!-- --> по лучшей цене в интернет-магазинах - от бюджетных до премиум. В каталоге можно найти всю необходимую для выбора информацию — сравнение <!-- -->товаров<!-- -->, подбор моделей по параметрам, подробные описания, поиск товара по названию, отзывы пользователей, фотогалереи товаров, глоссарий терминов, обзоры, инструкции, рейтинг товаров, рекомендации экспертов, каталог брендов и многое другое. Перепечатка любых материалов разрешена только с письменного согласия редакции.</noindex></div></div></div></div><div class="footer-style__FooterBottom-sc-5e53f7f6-1 konXTw"><div class="wrapper-style__Wrapper-sc-53eabab1-1 bTABjq"><div class="footer-style__FooterBottomContent-sc-5e53f7f6-2 iroqSO"><div class="footer-style__FooterBottomLeft-sc-5e53f7f6-19 eSaiox"><section data-no-hydrate="true"><div class="footer-style__FooterBottomOffer-sc-5e53f7f6-21 jeGrWS">Сайт <!-- -->dgm-online.ru<!-- --> не является интернет-магазином. <br/>Телефон для связи: <a href="tel:84951144444"> <!-- -->8 (495) 114-44-44</a>. <br/>E-mail: <a href="mailto:moskva@dgm-online.ru">moskva@<!-- -->dgm-online.ru<!-- --> </a>. <br/>Информация размещенная на сайте, не является публичной офертой</div></section><div class="footer-style__FooterBottomText-sc-5e53f7f6-23 bQkbHv responsive">Все права на бренд «<!-- -->DGM<!-- -->» принадлежат производителю</div><nav class="footer-style__FooterBottomLinks-sc-5e53f7f6-22 gazDUR"><a href="/info/agreement">Пользовательское соглашение</a><a href="/info/privacy">Политика обработки персональных данных</a></nav><div class="footer-style__FooterBottomText-sc-5e53f7f6-23 bQkbHv">Все права на бренд «<!-- -->DGM<!-- -->» принадлежат производителю</div></div><div class="footer-style__FooterBottomRight-sc-5e53f7f6-20 dRIxGt"><div class="footer-style__FooterBottomUpdateDate-sc-5e53f7f6-24 ROZoi">Обновлено <!-- -->18.07.2024<!-- --> в<!-- --> <!-- -->06:22<!-- --> по московскому времени.</div><div class="footer-style__FooterBootomCopyright-sc-5e53f7f6-25 fheyse"></div></div></div></div></div></footer></div></main></div><script id="__NEXT_DATA__" type="application/json">{"props":{"pageProps":{"popularCategories":[{"id":"01904a97-c2fb-7ccd-b071-6a02f3e187ea","name":"Пневмоинструменты","slug":"pnevmoinstrumenti","image":"/images/bc/32/c6/cb/c334cb8c.png","productsCount":123,"offersCount":123,"popularProduct":{"images":[],"__typename":"Product"},"products":[{"id":"01904a90-b738-56fb-5b10-5ad04fa86c98","slug":"dtp1252-pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125-mm-5-ekscentr.-5-mm-10-000-ob-min-180-l-min","name":"DTP1252, Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)","attributes":[],"reviewsCount":0,"offersCount":0,"price":3420,"priceFrom":3420,"priceTo":3420,"images":["/images/bd/d8/d0/25/d4a98b96.png"],"hit":null,"description":"","rating":4.41,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":14,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a90-b738-7f3c-4851-6a84fd7bd267","slug":"pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-180-l-min-diametr-kruga-125-mm-davlenie-vozduha-6-bar","name":"Пневмошлифмашина эксцентриковая DGM DTP-1252 (180 л/мин, диаметр круга 125 мм, давление воздуха 6 бар)","attributes":[{"name":"Диаметр воздушного штуцера, дюйм","value":"1/4"},{"name":"Диаметр диска, мм","value":"125"},{"name":"Крепление шлифлиста","value":"липучка"},{"name":"Макс. число оборотов, об/мин","value":"10000"},{"name":"Размер хода платформы, мм","value":"5"},{"name":"Расход воздуха, л/мин","value":"180"},{"name":"Частота колебаний, кол/мин","value":"10000"}],"reviewsCount":0,"offersCount":0,"price":2990,"priceFrom":2990,"priceTo":2990,"images":[],"hit":null,"description":"Пневматическая шлифовальная эксцентриковая машина DGM DTP-1252 - предназначена для выполнения шлифовальных работ по дереву, пластмассе, металлу, камню, композитам, лакокрасочным покрытиям, шпаклевке и иным материалам с подобными свойствами. Предлагает эргономичный дизайн, регулировку скорости и многое другое, чтобы сделать ваш следующий проект по шлифованию легким. Благодаря диаметру опорной пластины 125 мм / 5\", скорости вращения 10 000 об/мин, расходу воздуха 180 л/мин, ходу кулачка 5 мм, давлению 6,0 бар и соединительному отверстию 1/4\", эта пневматическая шлифовальная машина - идеальный способ убедиться, что ваша работа по шлифованию сделана правильно. Преимущества Эргономичный дизайн Регулировка скорости Диаметр опорной тарелки - 125 мм / 5\" Скорость вращения - 10 000 об/мин Расход воздуха - 180 л/мин Ход эксцентрика - 5 мм Давление - 6,0 бар Присоединительное отверстие - 1/4\"","rating":4.47,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a90-b73d-b6e8-68ed-d798198844a1","slug":"bezmaslyaniy-kompressor-dgm-ac-6100ld","name":"Безмасляный компрессор DGM AC-6100LD","attributes":[{"name":"Параметры сети","value":"230 В~, 50 Гц"},{"name":"Производительность","value":"450/250 л/мин"},{"name":"Тип смазки","value":"безмасляный"},{"name":"Вес брутто","value":"63,05 кг"},{"name":"Вес нетто","value":"58,1 кг"},{"name":"Количество цилиндров","value":"6"},{"name":"Ресивер","value":"100 л"},{"name":"Тип","value":"поршневой"},{"name":"Габариты компрессора","value":"113*36*69.4 см"},{"name":"Гарантийный срок","value":"12 месяцев"},{"name":"Максимальное давление","value":"8 аТм"},{"name":"Привод","value":"прямой"},{"name":"Габариты упаковки","value":"114*38*68 см"},{"name":"Передвижной","value":"Да"},{"name":"Потребляемая мощность","value":"2,4 кВт"},{"name":"Количество выходов","value":"2 быстросъема"},{"name":"Количество компрессорных групп","value":"3"}],"reviewsCount":0,"offersCount":0,"price":40800,"priceFrom":40800,"priceTo":40800,"images":["/images/af/93/c1/49/132d3ed2.png"],"hit":null,"description":"Компрессор малошумный безмасляный DGM AC-6100LD 3-х моторный и 6-ти поршневой - прекрасно подходит для медицинских учреждений в стоматологии. Не нагружает сеть питания при запуски всех своих двигателей. Производит чистый воздух свободный от примеси масел, в отличии от масляного аналога. Снижение шума работы на 50% по сравнению с масляным ременным компрессором, и на 70% по сравнению с прямым приводом масляного компрессора. Преимущества: - Для использования не требуется заливка масла; - 6-цилиндровый (3 компрессорные группы по 2 цилиндра); - Тефлоновые кольца на поршне с низким коэффициентом трения; - Электронный блок управления с возможностью отдельного запуска каждой компрессорной группы; - Функция последовательного запуска компрессорных групп, снижающая нагрузку на сеть электропитания; - ЖК-дисплей для отображения питающего напряжения; - Манометр давления в ресивере; - Манометр давления на выходе; - Регулятор давления; - 2 быстросъемных выхода; - Воздушные фильтры с бумажными фильтроэлементами; Комплектация: Компрессор; Фильтр воздушный (6 шт); Колесо транспортировочное (4 шт);Комплект крепежа; Руководство по эксплуатации; Коробка; Технические характеристики: Тип поршневой Тип смазки безмасляный Привод прямой Ресивер 100 л Потребляемая мощность 2,4 кВт Производительность 450/250 л/мин Параметры сети 230 В~, 50 Гц Максимальное давление 8 аТм Количество компрессорных групп 3 Количество цилиндров 6 Количество выходов 2 быстросъема Передвижной Да Вес нетто 58,1 кг Вес брутто 63,05 кг Габариты компрессора 113*36*69.4 см Габариты упаковки 114*38*68 см Гарантийный срок 12 месяцев","rating":4.26,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":17,"fiveStarCount":6,"__typename":"Product"},{"id":"01904a90-b73d-c1b6-7835-583dec37fe67","slug":"kompressor-dgm-ac-6100ld","name":"Компрессор DGM AC-6100LD","attributes":[],"reviewsCount":0,"offersCount":0,"price":38000,"priceFrom":38000,"priceTo":38000,"images":["/images/af/36/f1/c8/d0c8b6c1.png"],"hit":null,"description":"Купить Компрессор DGM AC-6100LD, Москва, Московская область","rating":4.4,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a90-b73d-c8d8-230c-c59c7e4efb6a","slug":"kompressor-bezmaslyaniy-dgm-ac-6100ld-2.4-kvt-450-l-min-resiver-100-l-6-cilindrov","name":"Компрессор безмасляный DGM AC-6100LD, 2.4 кВт, 450 л/мин, ресивер 100 л, 6 цилиндров","attributes":[],"reviewsCount":0,"offersCount":0,"price":40800,"priceFrom":40800,"priceTo":40800,"images":["/images/af/36/c4/5a/c0c8b6cb.png"],"hit":null,"description":"Описание Компрессор безмасляный DGM AC-6100LD, 2.4 кВт, 450 л/мин, ресивер 100 л, 6 цилиндров. Воздушный пневматический компрессор - переносное оборудование для периодических работ дома, на даче, в небольшой мастерской, где необходим чистый воздух, без примесей масла, а также для регулярной очистки от пыли офисной и бытовой техники. Особенности - Для использования не требуется заливка масла - 6-цилиндровый (3 компрессорные группы по 2 цилиндра) - Тефлоновые кольца на поршне с низким коэффициентом трения - Электронный блок управления с возможностью отдельного запуска каждой компрессорной группы - Функция последовательного запуска компрессорных групп, снижающая нагрузку на сеть электропитания - ЖК-дисплей для отображения питающего напряжения - Манометр давления в ресивере - Манометр давления на выходе - Регулятор давления - 2 быстросъемных выхода - Воздушные фильтры с бумажными фильтроэлементами","rating":4.37,"ratingCount":16,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":6,"__typename":"Product"},{"id":"01904a90-b75e-55d2-127c-12091156abe8","slug":"kompressor-dgm-ac-6100ld-bezmaslyaniy-450-l-min-8-atm-koaksialniy-bezmaslyaniy-elektr.-blok-upr.-resiv.-100-l-230-v-24-kvt-dg2720-3","name":"Компрессор DGM AC-6100LD безмасляный (450 л/мин, 8 атм, коаксиальный, безмасляный, электр. блок упр., ресив. 100 л, 230 В, 2,4 кВт) (DG2720-3)","attributes":[{"name":"Производитель","value":"DGM"}],"reviewsCount":0,"offersCount":0,"price":42920,"priceFrom":42920,"priceTo":42920,"images":["/images/af/36/c4/5a/c0c8b6cb.png"],"hit":null,"description":"--- Преимущества: - Надежный индукционный бесщеточный двигатель; - Для использования не требуется заливка масла; - 6-цилиндровый (3 компрессорные группы по 2 цилиндра); - Тефлоновые кольца на поршне с низким коэффициентом трения; - Электронный блок управления с возможностью отдельного запуска каждой компрессорной группы; - Функция последовательного запуска компрессорных групп, снижающая нагрузку на сеть электропитания; - ЖК-дисплей для отображения питающего напряжения; - Манометр давления в ресивере; - Манометр давления на выходе; - Регулятор давления; - 2 быстросъемных выхода; -Воздушные фильтры с бумажными фильтроэлементами; --- Технические характеристики: Тип: поршневой; Тип смазки: безмасляный; Привод: прямой; Ресивер: 100 л; Потребляемая мощность: 2,4 кВт; Производительность: 450 л/мин; Параметры сети: 230 В ~, 50 Гц; Максимальное давление: 8 атм; Количество компрессорных групп: 3; Количество цилиндров: 6; Количество выходов: 2 быстросъема; Передвижной: Да; Вес нетто: 58,1 кг; Вес брутто: 63,05 кг; Габариты компрессора: 113*36*69.4 см; Габариты упаковки: 114*38*68 см; Гарантийный срок: 12 месяцев; --- Комплектация: Компрессор; Фильтр воздушный (6 шт); Колесо транспортировочное (4 шт); Комплект крепежа; Руководство по эксплуатации; Коробка;","rating":4.37,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a90-b76d-7a9c-e8ad-49b521931f3d","slug":"dtp1252-dgm-pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125-mm-5-ekscentr.-5-mm-10-000-ob-min-180-l-min","name":"DTP1252 DGM Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5, Эксцентр.: 5 мм, 10 000 об/мин, 180 л/мин)","attributes":[],"reviewsCount":0,"offersCount":0,"price":2987,"priceFrom":2987,"priceTo":2987,"images":[],"hit":null,"description":"","rating":4.31,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a90-b776-61ef-9025-8b1a4e734375","slug":"pnevmoshlifmashina-dgm-dtp-1252-ekscentrikovaya","name":"Пневмошлифмашина DGM DTP-1252 эксцентриковая","attributes":[{"name":"Вес, г","value":"1250"},{"name":"Модель","value":"DGM DTP-1252 эксцентриковая"}],"reviewsCount":0,"offersCount":0,"price":2990,"priceFrom":2990,"priceTo":2990,"images":["/images/bd/68/d2/37/c4818d97.png"],"hit":null,"description":"Пневмошлифмашина DGM DTP-1252 эксцентриковая (тарелка 125мм/5\"; 10000об/мин; 180л/мин; 6бар; ход эксцентрика 5мм; вес 1.08кг) DTP-1252","rating":4.57,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":9,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a90-b77b-000e-1727-941262eed8dd","slug":"kompressor-dgm-ac-6100ld-dg2720-3","name":"Компрессор DGM AC-6100LD (DG2720-3)","attributes":[{"name":"Напряжение сети","value":"220 В"},{"name":"Объем ресивера","value":"100 л"},{"name":"Производительность на входе","value":"450 л/мин"},{"name":"Количество цилиндров","value":"6"},{"name":"Модель","value":"AC-6100LD (DG2720-3)"},{"name":"Давление","value":"8 атм"},{"name":"Мощность электродвигателя","value":"2.4 кВт"},{"name":"Производитель","value":"DGM"},{"name":"Вес","value":"58.1 кг"},{"name":"Габариты","value":"1130x360x694 мм"}],"reviewsCount":0,"offersCount":0,"price":42920,"priceFrom":42920,"priceTo":42920,"images":["/images/ae/36/d0/c9/92813f37.png"],"hit":null,"description":"Компрессор DGM AC-450F (DG2720-5) - это надежный и мощный инструмент для подачи сжатого воздуха к различному пневмоинструменту. Одним из главных преимуществ данной модели является то, что для ее использования не требуется заливка масла. Это значительно упрощает процесс обслуживания и эксплуатации компрессора. Колеса и ручка помогут без труда переместить агрегат в нужную точку. Особенности:Безмасляная модель;Защита от перегрузок;Тефлоновые кольца на поршне с низким коэффициентом трения;Электронный блок управления с возможностью отдельного запуска каждой компрессорной группы;Функция последовательного запуска компрессорных групп, снижающая нагрузку на сеть электропитания;ЖК-дисплей для отображения питающего напряжения;Два манометра измерения давления;Два разъема для подключения пневматического инструмента;Регулятор давления;Высокая производительность;Воздушный фильтр с поролоновым фильтроэлементом; Колеса и рукоятка помогают без труда перемещать компрессор по территории;Комплектация:Колесо транспортировочное - 4 шт;Фильтр воздушный- 6 шт;Комплект крепежа.","rating":4.62,"ratingCount":29,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":18,"__typename":"Product"},{"id":"01904a90-b781-ccc4-3ed3-52cd62e8ab40","slug":"dgm-pnevmoshlifmashina-ekscentrikovaya-dtp-1252","name":"DGM Пневмошлифмашина эксцентриковая DTP-1252","attributes":[],"reviewsCount":0,"offersCount":0,"price":2990,"priceFrom":2990,"priceTo":2990,"images":["/images/b4/c9/cb/36/c6858d96.png"],"hit":null,"description":"Пневмошлифмашина эксцентриковая DGM DTP-1252 (125 мм / 5\"; Эксцентр.: 5 мм; 10 000 об/мин; 180 л/мин)","rating":4.36,"ratingCount":30,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":19,"fiveStarCount":11,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-c174-0b78-d5c1-fab396f007d6","name":"Сварочное оборудование","slug":"svarochnoe-oborudovanie","image":"/images/be/e5/81/2c/865ed23c.png","productsCount":111,"offersCount":111,"popularProduct":{"images":["/images/bc/fa/ba/15/9511d189.png"],"__typename":"Product"},"products":[{"id":"01904a90-b779-ec72-ea7a-25989a88ee12","slug":"dgm-bp-05d","name":"DGM BP-05D","attributes":[],"reviewsCount":0,"offersCount":0,"price":2960,"priceFrom":2960,"priceTo":2960,"images":["/images/af/39/c0/d6/8fc61b06.png"],"hit":null,"description":"\u003cp\u003eНасосом нельзя перекачивать агрессивные, легко воспламеняющиеся или взрывчатые жидкости (например, бензин, масла, нитрорастворители), морскую воду, также жидкие пищевые продукты. Насос не предназначен для перекачивания питьевой воды. Категорически запрещается перекачивание грязной воды, содержащей абразивные вещества или длинноволокнистые включения. Насос может использоваться в интервале температуры от +10°С до +40°С. Электронасосы снабжены надежным и выносливым двигателем с термопредохранителем, крыльчатка и корпус, изготовленные из высококачественных материалов, обеспечивают долгий срок службы и безопасность работы. Имеют высокую производительность подачи воды, бесшумны, просты в обслуживании и установке.\u003c/p\u003e \u003cp\u003eВ характеристике насоса указано, что он самовсасывающий. В инструкции об этом нет ни слова, при установке на высоте 0,5м он может поднять воду на всасе на 5 см. Поэтому установил его рядом с емкостью ниже уровня воды, чтобы не мучится с заполнением через маленькую пробочку. Пришлось делать бандаж и гарантию на насос я потерял.\u003c/p\u003e \u003cul\u003e\u003cli\u003eПопробовал специально раздавить такого же диаметра чугунный уголок , заворачивая ниппель газовым ключом, не получилось.\u003c/li\u003e \u003cli\u003eСубъективный вывод: либо брак корпуса или чугун корпуса плохой.\u003c/li\u003e \u003cli\u003eПосле первого опробования насос постоял неделю и не смог запустится ( не провернулся).\u003c/li\u003e \u003cli\u003eЛегко задавливается пальцем руки на шланге (рабочее колёсико маленькое), но садовый дождеватель все же раскачал.\u003c/li\u003e\u003c/ul\u003e \u003cp\u003eНо с новым \" Ручейком\" не сравнить (напор 40м), тот выдает струи заметно больше, один минус как у всех вибрационных насосов - слишком шумный.\u003c/p\u003e","rating":4.32,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":17,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-e824-c86f-193f-d90812f977ac","slug":"dgm-nasos-drenazhniy-pogruzhnoy-1.5-kvt-bp-a110-v-moskve","name":"DGM Насос дренажный погружной 1.5 кВт BP-A110 в Москве","attributes":[],"reviewsCount":0,"offersCount":0,"price":9710,"priceFrom":9710,"priceTo":9710,"images":["/images/d5/52/ee/58/8f2d310e.png"],"hit":null,"description":"","rating":4.33,"ratingCount":18,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":6,"__typename":"Product"},{"id":"01904a91-3500-72b7-3afd-a0f23bc22909","slug":"plazmorez-dgm-cut-40","name":"Плазморез DGM CUT-40","attributes":[],"reviewsCount":0,"offersCount":0,"price":18900,"priceFrom":18900,"priceTo":18900,"images":["/images/bf/e5/e0/62/d21e8a1c.png"],"hit":null,"description":"Плазморез DGM CUT-40","rating":4.4,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":13,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a91-3501-0787-306f-33da40db21f4","slug":"apparat-plazmennoy-rezki-dgm-cut-40","name":"Аппарат плазменной резки DGM CUT-40","attributes":[{"name":"Aртикул","value":"CUT-40"}],"reviewsCount":0,"offersCount":0,"price":18340,"priceFrom":18340,"priceTo":18340,"images":["/images/b8/6c/c7/64/c99ac6c9.png","/images/b8/c7/c5/28/9f3cd036.png","/images/bc/c6/c7/62/c3389d1c.png","/images/bf/d2/91/3d/ca2b848c.png","/images/b0/35/9b/16/9b33cc99.png","/images/b2/cb/ce/93/cc349934.png","/images/e9/f0/86/c9/98356976.png","/images/eb/92/90/19/cb6b8f62.png"],"hit":null,"description":"Аппарат плазменной резки DGM CUT-40 - предназначен для резки низкоуглеродистой стали, нержавеющей стали, высокопрочной стали, легированной стали и других цветных металлов. Аппарату можно найти широкое применение в изготовлении металлоконструкций, котлов, производства труб, медицинского оборудования, машиностроения и многих других отраслях. Особенности: Инверторная технология IGBT; Высоковольтный контактный поджиг дуги; Газовый резак с эргономичной ручкой в комплекте; Регулятор расхода воздуха в комплекте; Складная ручкадля переноски; Требует подключения к воздушному компрессору с производительностью воздуха не менее 150 л/мин.","rating":4.5,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a91-350c-4d6c-a084-3e1e1225b19a","slug":"dgm-cut-40-plazmorez","name":"DGM CUT-40 Плазморез","attributes":[{"name":"Максимальный допустимый ток на входе","value":"25 А"},{"name":"Напряжение питающей сети","value":"220-240 В"},{"name":"Класс изоляции","value":"F"},{"name":"Максимальная толщина реза","value":"15 мм"},{"name":"Масса (без принадлежностей)","value":"5,1 кг"},{"name":"Номинальный выход","value":"15-40 A"},{"name":"Толщина реза цветных металлов","value":"9 мм"},{"name":"20°с","value":"60%"},{"name":"40°с (iec 60974-1)","value":"35 %"},{"name":"Гарантия","value":"12 месяцев"},{"name":"Фактор мощности","value":"Cos phi 0.91"},{"name":"Частота","value":"50/60Гц"},{"name":"Напряжение холостого хода","value":"270 В"},{"name":"Номинальный ток на входе","value":"14.8 А"},{"name":"Тип сети","value":"1 фаза"},{"name":"Эффективность, n","value":"0.91"},{"name":"Класс защиты","value":"IP21S"},{"name":"Масса (с принадлежностями)","value":"6,5 кг"},{"name":"Номинальное рабочее давление компрессора","value":"4,5-6 бар"}],"reviewsCount":0,"offersCount":0,"price":17490,"priceFrom":17490,"priceTo":17490,"images":["/images/be/c4/c1/62/d26a933e.png"],"hit":null,"description":"\u003cp\u003e\u003cstrong\u003eПреимущества:\u003c/strong\u003e\u003cbr\u003e- Инверторная технология IGBT; \u003cbr\u003e- Высоковольтный контактный поджиг дуги; \u003cbr\u003e- Газовый резак с эргономичной ручкой в комплекте; \u003cbr\u003e- Регулятор расхода воздуха в комплекте; \u003cbr\u003e- Складная ручка для переноски. \u003cbr\u003e\u003cbr\u003eТребует подключения к воздушному компрессору с производительностью воздуха не менее 150 л/мин. \u003c/p\u003e \u003chr\u003e \u003cp\u003e\u003cstrong\u003eТехнические характеристики:\u003c/strong\u003e\u003c/p\u003e \u003ctable\u003e \u003ctbody\u003e \u003ctr\u003e \u003ctd\u003eНапряжение питающей сети\u003c/td\u003e \u003ctd\u003e220-240 В\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eЧастота\u003c/td\u003e \u003ctd\u003e50/60Гц\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eТип сети\u003c/td\u003e \u003ctd\u003e1 фаза\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eНапряжение холостого хода\u003c/td\u003e \u003ctd\u003e270 В\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eНоминальный выход\u003c/td\u003e \u003ctd\u003e15-40 A\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eРабочий цикл (ПВ) на макс.токе\u003c/td\u003e \u003ctd\u003e\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003e40°С (IEC 60974-1)\u003c/td\u003e \u003ctd\u003e35 %\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003e20°С\u003c/td\u003e \u003ctd\u003e60%\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eНоминальный ток на входе\u003c/td\u003e \u003ctd\u003e14.8 А\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eМаксимальный допустимый ток на входе\u003c/td\u003e \u003ctd\u003e25 А\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eМаксимальная толщина реза\u003c/td\u003e \u003ctd\u003e15 мм\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eТолщина реза цветных металлов\u003c/td\u003e \u003ctd\u003e9 мм\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eПроизводительность подключаемого компрессора\u003c/td\u003e \u003ctd\u003e\u003e 150 л/мин\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eНоминальное рабочее давление компрессора\u003c/td\u003e \u003ctd\u003e4,5-6 бар\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eЭффективность, n\u003c/td\u003e \u003ctd\u003e0.91\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eФактор мощности\u003c/td\u003e \u003ctd\u003eCos phi 0.91\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eКласс изоляции\u003c/td\u003e \u003ctd\u003eF\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eКласс защиты\u003c/td\u003e \u003ctd\u003eIP21S\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eМасса (без принадлежностей)\u003c/td\u003e \u003ctd\u003e5,1 кг\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eМасса (с принадлежностями)\u003c/td\u003e \u003ctd\u003e6,5 кг\u003c/td\u003e \u003c/tr\u003e \u003ctr\u003e \u003ctd\u003eГарантия\u003c/td\u003e \u003ctd\u003e12 месяцев\u003c/td\u003e \u003c/tr\u003e \u003c/tbody\u003e \u003c/table\u003e \u003chr\u003e \u003cp\u003e\u003cstrong\u003eКомплектация:\u003c/strong\u003e\u003cbr\u003e\u003c/p\u003e \u003cp\u003eПлазморез - 1 шт. \u003cbr\u003eРезак плазменный 2.5 м с аксессуарами - 1 шт. \u003cbr\u003eКлемма заземления с кабелем 2 м - 1 шт. \u003cbr\u003eРегулятор давления воздуха - 1 шт. \u003cbr\u003eВоздушный шланг для подключения к компрессору 2 м - 1 шт. \u003cbr\u003eКронштейн крепления регулятора - 1 шт. \u003cbr\u003eРуководство по экс","rating":4.34,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":13,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a91-3519-366f-9c0f-fa3e7589eb96","slug":"plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig","name":"Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)","attributes":[],"reviewsCount":0,"offersCount":0,"price":19120,"priceFrom":19120,"priceTo":19120,"images":["/images/be/e4/c1/62/d21e8b9c.png"],"hit":null,"description":"Продажа Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг) не дорого с доставкой.","rating":4.31,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a91-3537-6666-e495-9c56c7873b7b","slug":"plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig-dg5820-1","name":"Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг) (DG5820-1)","attributes":[{"name":"Производитель","value":"DGM"}],"reviewsCount":0,"offersCount":0,"price":16410,"priceFrom":16410,"priceTo":16410,"images":["/images/9e/79/61/86/96599965.png"],"hit":null,"description":"Преимущества: - Инверторная технология IGBT; - Высоковольтный контактный поджиг дуги; - Газовый резак с эргономичной ручкой в комплекте; - Регулятор расхода воздуха в комплекте; - Складная ручкадля переноски. Требует подключения к воздушному компрессору с производительностью воздуха не менее 150 лмин. --- Технические характеристики: Напряжение питающей сети: 220-240 В; Частота: 5060Гц; Тип сети: 1 фаза; Напряжение холостого хода: 270 В; Номинальный выход: 15-40 A; Рабочий цикл (ПВ) на макс.токе: ; 40С (IEC 60974-1): 35 %; 20С: 60%; Номинальный ток на входе: 14.8 А; Максимальный допустимый ток на входе: 25 А; Максимальная толщина реза: 12 мм; Толщина реза цветных металлов: 8 мм; Производительность подключаемого компрессора: 150 лмин; Номинальное рабочее давление компрессора: 4,5-6 бар; Эффективность, n: 0.87; Фактор мощности: Cos phi 0.91; Класс изоляции: F; Класс защиты: IP21S; Масса (без принадлежностей): 4,7 кг; Масса (с принадлежностями): 6,1 кг; Гарантия: 12 месяцев; --- Комплектация: Плазморез - 1 шт. Резак плазменный PT-31 3 м - 1 шт. Электрод для плазменной резки - 2 шт. Сопло для плазменной резки - 2 шт. Клемма заземления с кабелем 2м - 1 шт. Регулятор давления воздуха - 1 шт. Кронштейн крепления регулятора - 1 шт. Руководство по эксплуатации - 1 шт. --- Совместимые товары: WGC-3130 Резак плазменный 3 м; WGC-3150 Резак плазменный 5 м; WA-3941 Диффузор изолирующий; WA-3940 Колпачок защитный; WA-3942 Сопло (набор 5 шт); WA-3943 Сопло удлиненное*** (набор 5 шт); WA-3944 Электрод (набор 5 шт); WA-3945 Электрод удлиненный*** (набор 5 шт); WA-2464 Электрод; WA-2468 Регулятор давления с манометром и фильтром; --- *** Примечание: удлиненное сопло используется в паре с удлиненным электродом.","rating":4.52,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":11,"__typename":"Product"},{"id":"01904a91-353a-971e-aada-4112af6bff99","slug":"dg58201-plazmorez-dgm-cut-40-220-v-15-40-a-visokovoltniy-podzhig","name":"DG58201, Плазморез DGM CUT-40 (220 В, 15-40 А, Высоковольтный поджиг)","attributes":[],"reviewsCount":0,"offersCount":0,"price":17700,"priceFrom":17700,"priceTo":17700,"images":[],"hit":null,"description":"","rating":4.55,"ratingCount":29,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":13,"fiveStarCount":16,"__typename":"Product"},{"id":"01904a91-3554-8088-9129-913462a9ed4b","slug":"dgm-plazmorez-cut-40","name":"DGM Плазморез CUT-40","attributes":[{"name":"Гарантия","value":"12 месяцев"},{"name":"Номинальное рабочее давление компрессора","value":"4,5-6 бар"},{"name":"Номинальный ток на входе","value":"14,8 А"},{"name":"Толщина реза цветных металлов","value":"9 мм"},{"name":"Класс защиты","value":"IP21S"},{"name":"Максимальная толщина реза","value":"15 мм"},{"name":"Напряжение холостого хода","value":"270 В"},{"name":"Номинальный выход","value":"15-40 А"},{"name":"Фактор мощности","value":"Cos phi 0.91"},{"name":"Частота","value":"50 / 60Гц"},{"name":"20 ° с","value":"60%"},{"name":"40 ° с (iec 60974-1)","value":"35%"},{"name":"Максимальный допустимый ток на входе","value":"25 А"},{"name":"Масса (без принадлежностей)","value":"5,1 кг"},{"name":"Масса (с принадлежностями)","value":"6,5 кг"},{"name":"Напряжение питающей сети","value":"220-240 В"},{"name":"Тип сети","value":"1 фаза"},{"name":"Класс изоляции","value":"F"},{"name":"Эффективность, n","value":"0.91"}],"reviewsCount":0,"offersCount":0,"price":16410,"priceFrom":16410,"priceTo":16410,"images":["/images/bf/d2/91/3d/ca2b848c.png"],"hit":null,"description":"- Инверторная технология IGBT; - Высоковольтный контактный поджиг дуги; - Газовый резак с эргономичной ручкой в комплекте; - Регулятор расхода воздуха в комплекте; - Складная ручкадля переноски.","rating":4.3,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":16,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a91-3589-cc78-928d-521026d3ab7a","slug":"rezak-plazmenniy-cut-wgc-31-3-m-solaris-analog-pt-31-solaris-pc-40-pc-41-dgm-cut-40-wgc-3130","name":"Резак плазменный CUT WGC-31 (3 м) SOLARIS (аналог PT-31; Solaris PC-40, PC-41; DGM CUT-40) (WGC-3130)","attributes":[{"name":"Длина","value":"3 м"}],"reviewsCount":0,"offersCount":0,"price":2530,"priceFrom":2530,"priceTo":2530,"images":["/images/f8/4c/87/b3/c4786ca5.png"],"hit":null,"description":"Резак плазменный CUT WGC-31 (3 м) SOLARIS (аналог PT-31; Solaris PC-40, PC-41; DGM CUT-40) (WGC-3130)","rating":4.53,"ratingCount":28,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":13,"fiveStarCount":15,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-d0ea-1d73-859f-daf4507caed4","name":"Оборудование для салонов красоты","slug":"oborudovanie-dlya-salonov-krasoti","image":"/images/ea/38/85/e5/9ed2989a.png","productsCount":95,"offersCount":95,"popularProduct":{"images":[],"__typename":"Product"},"products":[{"id":"01904a90-b73a-e50a-91b9-7c5bc5102b3d","slug":"paketi-kraft-bumazhnie-dlya-sterilizacii-dgm-steriguard-150250-mm","name":"Пакеты крафт бумажные для стерилизации DGM Steriguard 150*250 мм","attributes":[{"name":"Полное наименование","value":"Пакеты крафт бумажные для стерилизации DGM Steriguard 150*250 мм №100/1000"},{"name":"Разделы для прайса","value":"Пакеты для стерилизации бумажные"},{"name":"Высота (мм)","value":"20"},{"name":"Код","value":"ЦБ-00013875"},{"name":"Комплектация-первичная упаковка","value":"100"},{"name":"Объем ту","value":"0.017"},{"name":"Вес ту","value":"5.75"},{"name":"Длина (мм)","value":"270"},{"name":"Ндс","value":"20 %"},{"name":"Ширина (мм)","value":"150"},{"name":"Базовая единица","value":"шт"},{"name":"Размер ту","value":"32,5*32,5*12,5"},{"name":"Бренд","value":"DGM Steriguard"},{"name":"Страна бренда","value":"РОССИЯ"},{"name":"Страна производителя","value":"РОССИЯ"},{"name":"Транспортная упаковка (доп. реквизит)","value":"кор (1 000 шт)"}],"reviewsCount":0,"offersCount":0,"price":3,"priceFrom":3,"priceTo":3,"images":["/images/e1/c9/9e/b6/9e604969.png"],"hit":null,"description":"Пакеты крафт бумажные для стерилизации DGM Steriguard 150*250 мм №100/1000","rating":4.16,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":21,"fiveStarCount":4,"__typename":"Product"},{"id":"01904a90-b768-fc75-0a47-bc6dc1f60574","slug":"paketi-dlya-sterilizacii-dgm-steriguard-100h200-mm-korichneviy-100-sht-upk","name":"Пакеты для стерилизации DGM Steriguard, 100х200 мм, коричневый, 100 шт/упк","attributes":[],"reviewsCount":0,"offersCount":0,"price":407,"priceFrom":407,"priceTo":407,"images":["/images/b3/64/cc/32/b3cc6479.png"],"hit":null,"description":"Крафт пакеты DGM Sterigyard предназначены для медицинских изделий, подлежащих стерилизации паровым (Автоклав) и воздушным методами (Сухожар), с целью сохранения стерильности после стерилизации на 1 год. Изготовлены из медицинской крафт бумаги, имеют клеевую полосу для самозапечатывания на клапане пакета. На пакете нанесен химический индикатор первого класса, который позволяет отличить простерилизованные изделия от изделий, не подвергнутых стерилизационной обработке. В момент и после стерилизации не производят посторонних и резких запахов. Соответствуют ГОСТ ISO 11607-2011. Срок годности 5 лет.","rating":4.35,"ratingCount":17,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":6,"__typename":"Product"},{"id":"01904a90-b769-9d4a-b6f8-d1a20df758a0","slug":"dgm-steriguard-kraft-paket-dlya-sterilizacii-75h150-mm-200-sht","name":"DGM Steriguard, крафт-пакет для стерилизации (75х150 мм), 200 шт","attributes":[],"reviewsCount":0,"offersCount":0,"price":365,"priceFrom":365,"priceTo":365,"images":["/images/ae/d3/d0/28/852f7a78.png"],"hit":null,"description":"","rating":4.42,"ratingCount":28,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":16,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a90-b76b-a612-6b83-3997da692d8e","slug":"sredstvo-dezinficiruyushhee-dlya-pso-i-dvu-easy-oxy-dgm-steriguard","name":"Средство дезинфицирующее для ПСО и ДВУ EASY Oxy DGM Steriguard","attributes":[],"reviewsCount":0,"offersCount":0,"price":7744,"priceFrom":7744,"priceTo":7744,"images":["/images/90/1f/3f/3e/3a706ae0.png"],"hit":null,"description":"Средство дезинфицирующее для ПСО и ДВУ EASY Oxy DGM Steriguard на основе надуксусной кислоты 3,2% (двухкомпонентное); Для применения ручным и механизированным способами; -для дезинфекции медицинских изделий из различных материалов (5 мин.) -для дезинфекции высокого уровня (ДВУ) эндоскопов (5 мин.) -для стерилизации медицинских изделий из различных материалов (15 мин.); Срок годности компонентов средства (базового раствора и активатора) -2 года в невскрытой упаковке; Выпускается в емкостях по 5л; Для многократного применения (до 21 суток)","rating":4.52,"ratingCount":17,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":8,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a90-f68e-dcc7-e954-30d9d8909bdb","slug":"dgm-steriguard-indikatori-dlya-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-180s-60-min.","name":"DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации, класс 4, 180°С/60 мин.","attributes":[],"reviewsCount":0,"offersCount":0,"price":1440,"priceFrom":1440,"priceTo":1440,"images":["/images/ee/62/84/9d/9a705b63.png"],"hit":null,"description":"Одноразовые химические индикаторы для контроля процесса стерилизации (1000 шт.)","rating":4.4,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a90-f6d3-58a5-51c7-8429ee4c0159","slug":"indikator-dgm-steriguard-klass-4-tip-a-dlya-vnutr-i-snaruzhi","name":"Индикатор DGM Steriguard класс 4 тип А для внутр и снаружи","attributes":[],"reviewsCount":0,"offersCount":0,"price":989,"priceFrom":989,"priceTo":989,"images":[],"hit":null,"description":"Универсальный индикатор для использования внутри и снаружи упаковки. Новое улучшенное изменение цвета. Индикаторы разделены перфорацией. Удобная упаковка в виде твердого конверта с пакетом: защищает от влаги, солнечных лучей, механических повреждений и деформации. Вскрытие конверта одним движением руки (не требует ножниц).\u003cbr\u003e \u003cbr\u003e \u003cul\u003e \u003cli\u003eПрименение - внутри и вне стерилизационных упаковок.\u003c/li\u003e \u003cli\u003e Класс - 4.\u003c/li\u003e \u003cli\u003e Режим - 121 С, 20 мин.,126 С,-10 мин.,134 С,-5 мин\u003c/li\u003e \u003cli\u003e Количество - 1000 шт.\u003c/li\u003e \u003c/ul\u003e","rating":4.48,"ratingCount":31,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":16,"fiveStarCount":15,"__typename":"Product"},{"id":"01904a90-f6d5-2bc8-527f-39e2b9a08d11","slug":"chistove-indikator-dgm-steriguard-s-zhurnalom-1000-sht","name":"ЧИСТОВЬЕ Индикатор DGM Steriguard с журналом 1000 шт","attributes":[],"reviewsCount":0,"offersCount":0,"price":1912,"priceFrom":1912,"priceTo":1912,"images":["/images/f1/6c/8e/93/99cc8633.png"],"hit":null,"description":"","rating":4.44,"ratingCount":18,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-f6de-6041-a8f5-2f5b94fcb853","slug":"indikator-dlya-kontrolya-processa-parovoy-sterilizaciiavtoklav-dgm-steriguard-1000-sht.-s-zhurnalom","name":"Индикатор для контроля процесса паровой стерилизации(автоклав) \"DGM Steriguard\" 1000 шт. с журналом","attributes":[],"reviewsCount":0,"offersCount":0,"price":985,"priceFrom":985,"priceTo":985,"images":["/images/e2/a1/9d/5c/9e336364.png"],"hit":null,"description":"Индикатор химический одноразовый для контроля процесса паровой стерилизации \"DGM Steriguard\".Класс 4 для использования внутри и снаружи упаковки.Комплект индикаторов 1000 штук плюс журнал.Индикатор химический одноразовый для контроля процесса паровой стерилизации марки DGM Steriguard класс 4 тип А 121 град. С - 20 мин.126 град. С- 10 мин134 град. С - 5 мин.ГОСТ ISO 11140-1Индикаторы служат для документирования доказательств, подтверждающих, что вне и/или внутри автоклава цикл стерилизации был проведен корректно (выдержано время и температура). Применяют при каждом цикле стерилизации. В комплект входит журнал контроля работы автоклава.Если индикаторы используются как внешние, то количество индикаторов, помещаемых в стерилизаторы до 80 литров, - 5 штук. По истечении стерилизации эти индикаторы вклеиваются в журнал контроля работы стерилизатора.Если индикаторы используются как внутренние, то они могут закладываться как внутрь стерилизационной упаковки, так и приклеиваться на нее.Изменение цвета индикаторной метки на конечный является основанием для применения инструментов после стерилизации по назначению.Если хотя бы один индикаторов показал отрицательный результат, то изделие, обработанное в данном цикле, считают нестерильным и подвергают повторной дезинфекции и стерилизации.","rating":4.52,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a90-f6e0-bf81-65ad-760f516348fa","slug":"indikatori-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-dgm-steriguard","name":"Индикаторы контроля процесса воздушной стерилизации класс 4 DGM Steriguard","attributes":[],"reviewsCount":0,"offersCount":0,"price":1560,"priceFrom":1560,"priceTo":1560,"images":["/images/84/58/7b/aa/3bb496c5.png"],"hit":null,"description":"Индикаторы химические одноразовые DGM Steriguard, предназначены для контроля процесса воздушной стерилизации по режиму 180°С/60 минут, внутри стерилизационных упаковок с изделиями, так и снаружи стерилизационных упаковок. Соответствует классу 4 по ГОСТ ISO 11140-1-2011; В комплект поставки входит 1000 тестов и журнал учета по Ф.257/у. Срок годности 3 года.","rating":4.5,"ratingCount":28,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":14,"fiveStarCount":14,"__typename":"Product"},{"id":"01904a90-f6e7-97f5-94cc-ccde66cb921b","slug":"indikator-dgm-steriguard-universalniy-s-zhurnalom-dlya-avtoklavov-bumaga--1000-sht-upk--art.601-690","name":"Индикатор DGM Steriguard универсальный с журналом для автоклавов Бумага , 1000 шт/упк , арт.601-690","attributes":[],"reviewsCount":0,"offersCount":0,"price":1540,"priceFrom":1540,"priceTo":1540,"images":["/images/e2/a3/99/cc/9e995332.png"],"hit":null,"description":"Индикатор DGM Steriguard универсальный с журналом для автоклавов Бумага , 1000 шт/упк , арт.601-690","rating":4.55,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":14,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-cae8-804e-f77f-5f96c3c83fae","name":"Расходные материалы и оснастка","slug":"rashodnie-materiali-i-osnastka","image":"/images/bc/93/c3/6c/16a539d2.png","productsCount":67,"offersCount":67,"popularProduct":{"images":["/images/f1/9a/6c/3c/e7312c98.png"],"__typename":"Product"},"products":[{"id":"01904a90-b73d-0d59-0d29-374efec3dde1","slug":"kompressor-bezmaslyaniy-koaksialniy-220v-24kvt-450l-min-100l-8-bar-elektr.-upr.ac-6100ld-dgm-dg2720-3","name":"Компрессор безмасляный коаксиальный 220V 2,4кВт 450л/мин 100л 8 бар электр. упр.AC-6100LD, DGM DG2720-3","attributes":[],"reviewsCount":0,"offersCount":0,"price":42920,"priceFrom":42920,"priceTo":42920,"images":[],"hit":null,"description":"Компрессор безмасляный коаксиальный 220V 2,4кВт 450л/мин 100л 8 бар электр. упр.AC-6100LD, DGM","rating":4.4,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-c345-bed6-c2c6-85d42bf7d545","slug":"benzopila-perenosnaya-dgm-gs-282-cherno-zelenaya","name":"Бензопила переносная DGM GS-282 черно-зеленая","attributes":[],"reviewsCount":0,"offersCount":0,"price":7180,"priceFrom":7180,"priceTo":7180,"images":["/images/bb/e0/c4/1c/7ad0952f.png"],"hit":null,"description":"","rating":4.36,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":14,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-c347-5c56-5400-3c0437560803","slug":"benzinovaya-pila-dgm-gs-282-2800-vt","name":"Бензиновая пила DGM GS-282 2800 Вт","attributes":[{"name":"Производитель","value":"DGM"},{"name":"Тип двигателя","value":"бензиновый"},{"name":"Шаг цепи","value":"0.325 дюйма"},{"name":"Длина шины","value":"45 см"},{"name":"Мощность","value":"2800 Вт"}],"reviewsCount":0,"offersCount":0,"price":5190,"priceFrom":5190,"priceTo":5190,"images":["/images/bb/f3/85/2f/4a90a64c.png"],"hit":null,"description":"Технические характеристики Бензиновая пила DGM GS-282 2800 ВтОбщие характеристикиПроизводительDGMТип двигателябензиновыйМощность2800 ВтКоличество скоростей1Шаг цепи0.325 дюймаОбработкаДлина шины45 смПроизводительностьСкорость вращения7500 об/минДополнительноЕмкость топливного бака0.55 лЕмкость масляного бака0.26 лФункции и возможностиантивибрацияУровень шума105 дБКомплект поставкицепь, шина, пластиковый кожух, зубчатый упор, cвечной ключ, емкость для смешивания топливной смеси, набор инструмента, напильник.Вес6.5 кгМодификация (код производителя)GS-282Особенностиподходит: цепь ECO 45 см 18\" (CSP-029) шина ECO 45 см 18\" (CSP-028)Полная информация о товаре, изготовителе, комплектации, технических характеристиках и функциях содержится в технической документации.","rating":4.31,"ratingCount":29,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":20,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a90-c42e-c5ff-a51b-311723ccdfb9","slug":"benzopila-dgm-gs-282","name":"Бензопила DGM GS-282","attributes":[],"reviewsCount":0,"offersCount":0,"price":6370,"priceFrom":6370,"priceTo":6370,"images":["/images/ec/c6/93/3b/6ac42533.png"],"hit":null,"description":"Мощная и производительная бензопила DGM, оснащенная шиной 18\" (45 см) отлично подходит для широкого круга задач по уходу за садовым участком.Комплект: цепь, шина, пластиковый кожух, зубчатый упор, cвечной ключ, емкость для смешивания топливной смеси, набор инструмента, напильник.","rating":4.32,"ratingCount":28,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":19,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a90-c42f-93e3-0ffa-a7d71ad2517c","slug":"dgm-gs-282","name":"DGM GS-282","attributes":[],"reviewsCount":0,"offersCount":0,"price":4371,"priceFrom":4371,"priceTo":4371,"images":[],"hit":null,"description":"","rating":4.28,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":6,"__typename":"Product"},{"id":"01904a90-c4c2-29aa-6ce4-3ac87041a1c5","slug":"benzopila-dgm-gs-282-1.5mm-72zv.","name":"Бензопила DGM GS-282 1.5мм 72зв.","attributes":[],"reviewsCount":0,"offersCount":0,"price":7100,"priceFrom":7100,"priceTo":7100,"images":["/images/ec/c6/93/19/6cc4953b.png"],"hit":null,"description":"Бензопила \"DGM\" GS-282 1.5мм 72зв.","rating":4.5,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":11,"__typename":"Product"},{"id":"01904a90-c536-0f37-3b8d-e513b2e67e8b","slug":"benzopila-dgm-gs-282-shina-45-sm-18-0.325-1.5-mm-72-zv.-2.80-kvt-ves-6.5-kg","name":"Бензопила DGM GS-282 шина 45 см (18\"), 0.325\", 1.5 мм, 72 зв. (2.80 кВт, вес 6.5 кг)","attributes":[],"reviewsCount":0,"offersCount":0,"price":6250,"priceFrom":6250,"priceTo":6250,"images":["/images/b3/e2/c4/0c/7ad0b16f.png"],"hit":null,"description":"Мощная и производительная бензопила DGM, оснащенная шиной 18\" (45 см) отлично подходит для широкого круга задач по уходу за садовым участком.---Технические характеристики:Тип двигателя: одноцилиндровый, двухтактный, с воздушным охлаждением;Максимальная мощность: 2,8 кВт (7500 об/мин);Скорость холостого хода: 3000 об/мин;Шаг цепи: 0,325\";Количество звеньев: 72 шт;Толщина ведущего зуба: 1,5 мм;Длина шины: 18\" / 45 см;Топливо, смесь бензина и масла: 25:1;Объём топливного бака: 550 мл;Тип масла для топливной смеси: двухтактное;Объём масляного бака: 260 мл;Тип масла длясмазки цепи: автомобильное моторное масло;Уровень шума: 105 дБа;Масса нетто: 6,5 кг;Масса брутто: 7,7 кг;---Комплект: цепь, шина, пластиковый кожух, зубчатый упор, cвечной ключ, емкость для смешивания топливной смеси, набор инструмента, напильник.Гарантийный срок: 12 месяцевПодходит:цепь ECO 45 см 18\" арт. CSP-029шина ECO 45 см 18\" арт. CSP-028шина ECO 45 см 18\" арт. CSP-035","rating":4.32,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":17,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-c761-ff8c-6886-ddc45fb3a9a4","slug":"dgm-bp-a111","name":"DGM BP-A111","attributes":[],"reviewsCount":0,"offersCount":0,"price":7260,"priceFrom":7260,"priceTo":7260,"images":["/images/e7/c2/95/68/d334c94e.png"],"hit":null,"description":"Продажа DGM BP-A111 не дорого с доставкой.","rating":4.4,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a90-e849-1d9e-6311-ff25cdc1c0a7","slug":"gidromodul-dlya-chillera-dantex-dgm-pm1p11-3w9-18","name":"Гидромодуль для чиллера Dantex DGM-PM1P1(1-3)W(9-18)","attributes":[],"reviewsCount":0,"offersCount":0,"price":174397,"priceFrom":174397,"priceTo":174397,"images":["/images/eb/6b/94/1e/90b7c990.png"],"hit":null,"description":"🗹 В наличии Артикул: 0008070 Серия DGM-W Гидромодули без аккумулирующего бака. Потребляемая мощностью от 0,45 до 22 кВт. Расход воды от 1 до 216 м3/ч. Напор от 6 до 48 метр..","rating":4.38,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":13,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-ee67-bfed-9b2f-f34796ac86bd","slug":"gs232-benzopila-dgm-gs-232-shina-40-sm-16-3-8-1.3-mm-57-zv.-2.30-kvt-40sm-16-ves-55-kg","name":"GS232, Бензопила DGM GS-232 шина 40 см (16), 3/8, 1.3 мм, 57 зв. (2.30 кВт, 40см (16), вес 5,5 кг)","attributes":[],"reviewsCount":0,"offersCount":0,"price":6460,"priceFrom":6460,"priceTo":6460,"images":["/images/e1/b1/d2/7a/0b45d86b.png"],"hit":null,"description":"","rating":4.38,"ratingCount":18,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":7,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-c8ca-7ceb-fd81-17177720c35c","name":"Электроинструменты","slug":"elektroinstrumenti","image":"/images/e8/9e/97/61/9626ce26.png","productsCount":44,"offersCount":44,"popularProduct":{"images":["/images/b4/a7/c7/58/9936668a.png"],"__typename":"Product"},"products":[{"id":"01904a90-b738-27cb-2a8a-6dd954ef503b","slug":"ekscentrikovaya-pnevmoshlifmashina-dgm-dtp-1252","name":"Эксцентриковая пневмошлифмашина DGM DTP-1252","attributes":[],"reviewsCount":0,"offersCount":0,"price":2990,"priceFrom":2990,"priceTo":2990,"images":[],"hit":null,"description":"Эксцентриковая пневмошлифмашина DGM DTP-1252","rating":4.54,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a90-b738-cadb-f55d-484d663545ed","slug":"pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-125mm","name":"Пневмошлифмашина эксцентриковая DGM DTP-1252 125мм","attributes":[],"reviewsCount":0,"offersCount":0,"price":3400,"priceFrom":3400,"priceTo":3400,"images":["/images/b4/c9/c3/36/c6958d96.png"],"hit":null,"description":"Пневмошлифмашина эксцентриковая DGM DTP-1252 125мм","rating":4.4,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":13,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a90-b73d-51a4-4c99-15140e13d97a","slug":"kompressor-dgm-as-6100ld","name":"Компрессор DGM АС-6100LD","attributes":[],"reviewsCount":0,"offersCount":0,"price":40800,"priceFrom":40800,"priceTo":40800,"images":[],"hit":null,"description":"Компрессор DGM АС-6100LD","rating":4.51,"ratingCount":29,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":14,"fiveStarCount":15,"__typename":"Product"},{"id":"01904a90-b73d-ddca-b7db-20535982a16c","slug":"shlifovalnaya-mashina-ekscentrikovaya-dgm-dtp-1252-cherno-golubaya-12-h-13-h-215-sm","name":"Шлифовальная машина эксцентриковая DGM DTP-1252 черно-голубая 12 х 13 х 21,5 см","attributes":[],"reviewsCount":0,"offersCount":0,"price":2990,"priceFrom":2990,"priceTo":2990,"images":[],"hit":null,"description":"Пневмошлифмашина эксцентриковая DGM DTP-1252 с эргономичным дизайном. Скорость вращения 10000 оборотов в минуту, имеется регулировка скорости. Расход воздуха 180 литров в минуту.","rating":4.54,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a90-b73e-5710-5e83-348deb5104e8","slug":"mashina-shlifovalnaya-ekscentrikovaya-5-125mm-dgm-dtp-1252","name":"Машина шлифовальная эксцентриковая 5/125мм, DGM DTP-1252","attributes":[],"reviewsCount":0,"offersCount":0,"price":2990,"priceFrom":2990,"priceTo":2990,"images":[],"hit":null,"description":"Машина шлифовальная эксцентриковая 5/125мм , DGM","rating":4.5,"ratingCount":30,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":15,"__typename":"Product"},{"id":"01904a90-b73e-7f3a-4e41-28e6e19e672c","slug":"pnevmoshlifmashina-ekscentrikovaya-dgm-dtp-1252-v-moskve","name":"Пневмошлифмашина эксцентриковая DGM DTP-1252 в Москве","attributes":[],"reviewsCount":0,"offersCount":0,"price":3499,"priceFrom":3499,"priceTo":3499,"images":["/images/bd/c8/d2/25/d4a98b96.png"],"hit":null,"description":"","rating":4.41,"ratingCount":17,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a90-b775-910f-5e78-b272f2241c58","slug":"pnevmaticheskaya-shlifmashinka-ekscentrikovaya-125mm-dtp-1252-dgm","name":"Пневматическая шлифмашинка эксцентриковая 125мм DTP-1252, DGM","attributes":[],"reviewsCount":0,"offersCount":0,"price":2990,"priceFrom":2990,"priceTo":2990,"images":[],"hit":null,"description":"Пневматическая эксцентриковая шлифовальная машина 125 мм DGM DTP-1252 – предназначена для шлифования и полирования ровных и выпуклых поверхностей из дерева пластмасс, цветных металлов, стали и аналогичных материалов, шпатлеванных или покрытых лаком верностей. Полировальная пневмошлифмашина подходит для зачистки сварных швов и заусенцев на металлических изделиях, полировки авто, фар, шлифования тонких сварных швов, полирования и реставрации мебели, пола, потолков, стен. Мини пневмошлифовальная машинка работает от воздушного компрессора, с рабочим давлением в 6 бар и расходом воздуха - 180 л/мин. Это дает возможность работать длительное время без перерыва в отличие от электрического инструмента. Легкая 1,08 кг благодаря отсутствию мотора в корпусе. Пневмоинструмент подходит для мокрого и сухого шлифования. Шлифовка имеет регулировку скорости воздушного потока, что удобно при обработке различного материала и работе с кругами с разным типом зернистости. Максимальная скорость вращения в 10 000 об/мин при ходе эксцентрика в 5 мм. Рабочим инструментом шлифмашины является пластиковый диск с липучкой (опорная тарелка), на который крепится шлифовальный круг 126 мм / 5\". Присоединительное отверстие 1/4\". Корпус изделия изготовлен из прочного пластика, а рукоятка оснащена прорезиненной оболочкой, для хорошего удержания инструмента и низкого уровеня вибрации. Гарантийный срок 1 год.","rating":4.41,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":14,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a90-f6c8-d1d6-1b50-12c9bfa226d2","slug":"indikator-dgm-steriguard-134-5-univers.-s-zhur.-dlya-avtoklavov-1000-sht-upak","name":"Индикатор DGM Steriguard 134/5 универс. с жур. для автоклавов 1000 шт/упак","attributes":[],"reviewsCount":0,"offersCount":0,"price":1147,"priceFrom":1147,"priceTo":1147,"images":["/images/ee/c2/84/9d/9a705b63.png"],"hit":null,"description":"Индикатор DGM Steriguard 134/5 универс. с жур. для автоклавов 1000 шт/упак","rating":4.56,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a90-f6d4-6d4d-e73c-88f5eda7def6","slug":"indikator-universalniy-s-zhurnalom-dlya-avtoklavov-dgm-steriguard-1000-sht-upak","name":"Индикатор универсальный с журналом для автоклавов DGM Steriguard 1000 шт/упак","attributes":[],"reviewsCount":0,"offersCount":0,"price":1539,"priceFrom":1539,"priceTo":1539,"images":["/images/e2/a3/91/cc/9c98d376.png"],"hit":null,"description":"","rating":4.33,"ratingCount":18,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":6,"__typename":"Product"},{"id":"01904a90-f6da-2844-26c5-75a207af3ea0","slug":"indikator-sterilizacii-dgm-steriguard-vozduh-dlya-ispolzovaniya-vnutri-snaruzhi-180-60-1000-sht","name":"Индикатор стерилизации DGM Steriguard воздух для использования внутри/снаружи 180/60 1000 шт","attributes":[],"reviewsCount":0,"offersCount":0,"price":490,"priceFrom":490,"priceTo":490,"images":["/images/ae/1c/95/e6/cccc0d3a.png"],"hit":null,"description":"Описание Индикаторы 4 класса предназначены для следующих режимов: \u003e для форвакуумных стерилизаторов (размещение внутри упаковки и в камере): •121°С – 20 мин., 126°С – 10 мин, 134°С – 5 мин., •121°С – 20 мин., 126°С – 10 мин, 134°С – 7 мин. \u003e для гравитационных стерилизаторов •120°С – 45 мин., 132°С – 20 мин. (размещение внутри упаковки) •120°С – 45 мин., 132°С – 20 мин. (размещение в камере) \u003e для воздушной стерилизации (размещение внутри упаковки и в камере): •180°С – 60 мин.","rating":4.62,"ratingCount":29,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":18,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-c355-2ac5-1cfc-46815f8a98e6","name":"Оснастка к садовой технике","slug":"osnastka-k-sadovoy-tehnike","image":"/images/ea/4b/59/db/478c8534.png","productsCount":41,"offersCount":41,"popularProduct":{"images":["/images/ea/4a/5a/da/e68ca1a5.png"],"__typename":"Product"},"products":[{"id":"01904a90-c347-2eb8-0d9e-c6e8da1ce9d5","slug":"benzopila-dgm-gs-282-shina-45sm.-0325-15mm.-72zv.","name":"Бензопила DGM GS-282 шина 45см. 0,325 1,5мм. 72зв.","attributes":[],"reviewsCount":0,"offersCount":0,"price":4930,"priceFrom":4930,"priceTo":4930,"images":["/images/ec/c6/93/3b/6ac42533.png"],"hit":null,"description":"Описание Мощная и производительная бензопила DGM, оснащенная шиной 18","rating":4.56,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a90-ee59-c4ce-1226-42c92ff7c4ed","slug":"benzopila-dgm-gs-232-shina-40sm-16-3-8-13mm-57-zvenev","name":"Бензопила DGM GS-232 шина 40см (16\") 3/8\", 1,3мм, 57 звеньев","attributes":[{"name":"Max число оборотов","value":"7500 об/мин"},{"name":"Гарантия","value":"12 месяцев"},{"name":"Ширина паза","value":"1,3 мм"},{"name":"Шаг цепи","value":"3/8 дюйма"},{"name":"Масса","value":"6,5 кг"},{"name":"Мощность","value":"2,3 кВт"},{"name":"Объем масляного бака","value":"260 мл"},{"name":"Объем топливного бака","value":"550 мл"},{"name":"Объём двигателя","value":"52 см3"},{"name":"Страна производства","value":"Китай"},{"name":"Число оборотов холостого хода","value":"3000 об/мин"}],"reviewsCount":0,"offersCount":0,"price":6000,"priceFrom":6000,"priceTo":6000,"images":["/images/b2/a6/c1/47/975cc81f.png"],"hit":null,"description":"Бензопила DGM GS-232 шина 40см (16\") 3/8\", 1,3мм, 57 звеньев","rating":4.44,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":14,"fiveStarCount":11,"__typename":"Product"},{"id":"01904a90-f46c-2030-3e11-6ad263a0ea01","slug":"trimmer-benzinoviy-dgm-bc-210-43sm3-25-l.s-nozh-3t-plus-leska-nerazbornaya-7.3-kg","name":"Триммер бензиновый DGM BC-210 43см3 2,5 л.с нож 3Т+леска, неразборная, 7.3 кг","attributes":[],"reviewsCount":0,"offersCount":0,"price":9800,"priceFrom":9800,"priceTo":9800,"images":["/images/f6/52/5a/da/728ca82b.png"],"hit":null,"description":"Триммер бензиновый DGM BC-210 43см3 2,5 л.с нож 3Т+леска, неразборная, 7.3 кг","rating":4.4,"ratingCount":27,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":16,"fiveStarCount":11,"__typename":"Product"},{"id":"01904a90-f476-e997-6dd6-9266070018e9","slug":"gazonokosilka-dgm-bc-210-cena-kupit-v-moskve-otzivi-harakteristiki-obzor","name":"Газонокосилка DGM BC-210 цена, купить в Москве, отзывы, характеристики, обзор","attributes":[],"reviewsCount":0,"offersCount":0,"price":8768,"priceFrom":8768,"priceTo":8768,"images":["/images/d6/52/5a/98/e08fa9ab.png"],"hit":null,"description":"BC-210 от производителя DGM в АВШоп (аудио видео каталог). Отзывы владельцев, обсуждения, характеристики и параметры. Видео обзоры, история, динамика и предложения цен. Задавайте вопросы и получайте ответы.","rating":4.29,"ratingCount":27,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":19,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-f49b-1d9d-f419-1598be1032f2","slug":"dgm-motokosa-bc-210-s-nozhom-i-golovkoy","name":"DGM Мотокоса BC-210 с ножом и головкой","attributes":[],"reviewsCount":0,"offersCount":0,"price":7520,"priceFrom":7520,"priceTo":7520,"images":["/images/fa/42/da/da/630ce135.png"],"hit":null,"description":"Особенность поставки данной модели: редуктор, крепление ручки и сцепление не установлены на штангу, необходимо установить все части самостоятельно. Штанга идет в групповой упаковке по 10шт. В отгрузках не кратным 10шт штанги будут без коробки! Особенности: - Мощный двигатель - Эргономичная форма рукояток - 3Т нож и косильная головка в комплекте --- Технические характеристики: Тип двигателя: двухтактный, воздушного охлаждения; Максимальная мощность двигателя (при 7500 об/мин): 2,1 кВт; Максимальная частота вращения: 9000-10000 об/мин; Частота холостых оборотов: 3000+10% об/мин;Штанга: цельная 26мм; Объём топливного бака: 1,2 л; Леска: d2,4 мм/2,5 м; Нож: 1,4x255 мм/3 лопасти; Диаметр рабочей зоны: ; нож: 255 мм; леска: 430 мм; Ремень: одноплечный; Масса нетто / брутто: 7,3 / 9,0 кг; Топливная смесь: 1 (масло) : 25 (топливо АИ-92)*; Допустимый уровень шума: 114 + 3 дБА; Допустимый уровень вибрации: 1,4+0,3 м/с10-2; Гарантийный срок: 12 месяцев; ---","rating":4.4,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-f49b-e33f-1d3f-b1263f78bc51","slug":"benzinoviy-trimmer-dgm-bc-210","name":"Бензиновый триммер DGM BC-210","attributes":[],"reviewsCount":0,"offersCount":0,"price":7925,"priceFrom":7925,"priceTo":7925,"images":["/images/f3/d2/5a/9a/e02fa921.png"],"hit":null,"description":"Тип: бензиновыйМощность: 2100 ВтШирина скашивания: 43 смРасположение двигателя: верхнееФорма штанги: прямаяСкорость вращения: 10000 об/минРежущая оснастка: металлический нож","rating":4.54,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a91-0579-fa3f-4020-0b184ec6f595","slug":"komplekt-dlya-samovsasivaniya-dgm-dgwt900017-bescvetniy","name":"Комплект для самовсасывания DGM (DGWT900017) бесцветный","attributes":[],"reviewsCount":0,"offersCount":0,"price":750,"priceFrom":750,"priceTo":750,"images":["/images/ec/9b/e6/61/92669b44.png"],"hit":null,"description":"Комплект для самовсасывания DGM (DGWT900017) бесцветный","rating":4.42,"ratingCount":19,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a91-0940-7d89-17ff-ccb65d426b1c","slug":"opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-dvigatel-09kvt-bak-25-l-davlenie-25-mpa-ph-271","name":"Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа) (PH-271)","attributes":[],"reviewsCount":0,"offersCount":0,"price":10990,"priceFrom":10990,"priceTo":10990,"images":["/images/b2/cc/89/33/cc33778c.png"],"hit":null,"description":"","rating":4.61,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":8,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a91-095f-f971-e736-4d643fd6fe6c","slug":"opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-dvigatel-09kvt-bak-25-l-davlenie-25-mpa","name":"Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т двигатель 0,9кВт; бак 25 л; давление 2,5 МПа)","attributes":[],"reviewsCount":0,"offersCount":0,"price":10320,"priceFrom":10320,"priceTo":10320,"images":["/images/da/a5/74/4a/b5699272.png","/images/db/96/2d/b0/4ac3d6c8.png","/images/e6/99/98/66/99660bdc.png","/images/b2/cc/89/73/cc3347cc.png","/images/e9/6f/c0/30/8f87b9c8.png","/images/ea/85/25/4c/ca778277.png","/images/ea/85/25/4e/c8779372.png","/images/ea/9d/95/6a/85699562.png","/images/ea/9d/95/6a/c748a562.png","/images/ec/d4/a7/6a/9463d885.png"],"hit":null,"description":"бензиновый, 25 л, расход 5.1 л/мин, 25 бар, корпус: пластик, штанга: сталь, телескопическая штанга, белый, 9.4 кг","rating":4.57,"ratingCount":26,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":15,"__typename":"Product"},{"id":"01904a91-096a-880c-e355-63575b684d4b","slug":"ph271-dgm-opriskivatel-ranceviy-benzinoviy-dgm-ph-271-2t-09kvt-bak-25-l-davlenie-25-mpa","name":"PH271 DGM Опрыскиватель ранцевый бензиновый DGM PH-271 (2Т 0,9кВт, бак 25 л, давление 2,5 МПа)","attributes":[],"reviewsCount":0,"offersCount":0,"price":11287,"priceFrom":11287,"priceTo":11287,"images":[],"hit":null,"description":"","rating":4.59,"ratingCount":27,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":16,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-da23-3e24-93cf-9a1dcb1a13b6","name":"Мойки ВД и аксессуары","slug":"moyki-vd-i-aksessuari","image":"/images/bc/c7/c6/cc/9438c137.png","productsCount":33,"offersCount":33,"popularProduct":{"images":["/images/b3/cc/cc/33/643333cc.png"],"__typename":"Product"},"products":[{"id":"01904a91-0519-0622-fef1-87a32a31ce39","slug":"ochistitel-visokogo-davleniya-dgm-water-140-1.65-kvt-135-bar-420-l-ch-samovsasivanie-aktivniy-penogenerator-dgwt140001","name":"Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001)","attributes":[],"reviewsCount":0,"offersCount":0,"price":7180,"priceFrom":7180,"priceTo":7180,"images":["/images/e5/c6/9c/34/e6199966.png"],"hit":null,"description":"Преимущества:Алюминиевый корпус насоса высокого давления;Функция самовсасывания позволяет использовать очиститель без подключения к водопроводу;Веерная и грязевая форсунки в комплекте;Пеногенератор для распыления моющей пены;Фильтр тонкой очистки в комплекте;---Технические характеристики:Потребляемая мощность двигателя: 1650 Вт;Параметры сети электропитания: 220-240 В/50 Гц +/-15%;Максимально допустимое давление: 135 бар;Максимальный расход воды: 420 л/ч;Максимальная температура воды на входе: 50°С;Емкость пеногенератора: 500 мл;Длина шланга в/д: 5 м;Длина электрокабеля: 5 м;Вес: 6,35 кг;Гарантийный срок: 1 год;---Комплектация:Очиститель высокого давления;Шланг высоконапорный - 5 м;Пистолет;Удлинительная насадка;Веерная фреза;Грязевая фреза;Инструмент для чистки форсунки;Входной минифильтр-коннектор 1/2\";Пеногенератор;---Совместимые товары:DGWT900011 Пистолет распылительный;DGWT900012 Трубка струйная;DGWT900013 Распылительная насадка веерная (150 бар макс);DGWT900015 Грязевая фреза;DGWT900016 Пеногенератор активный;DGWT900017 Комплект для самовсасывания;DGWT900018 Шланг напорный 5 м;---","rating":4.33,"ratingCount":27,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":18,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a91-0567-9a65-3148-448437b00e88","slug":"moyka-visokogo-davleniya-dgm-water-140","name":"Мойка высокого давления DGM Water 140","attributes":[],"reviewsCount":0,"offersCount":0,"price":7180,"priceFrom":7180,"priceTo":7180,"images":["/images/8e/c7/e1/ce/8718f132.png"],"hit":null,"description":"Преимущества:Алюминиевый корпус насоса высокого давления;Функция самовсасывания позволяет использовать очиститель без подключения к водопроводу;Веерная и грязевая форсунки в комплекте;Пеногенератор для распыления моющей пены;Фильтр тонкой очистки в комплекте;---Технические характеристики:Потребляемая мощность двигателя: 1650 Вт;Параметры сети электропитания: 220-240 В/50 Гц +/-15%;Максимально допустимое давление: 135 бар;Максимальный расход воды: 420 л/ч;Максимальная температура воды на входе: 50°С;Емкость пеногенератора: 500 мл;Длина шланга в/д: 5 м;Длина электрокабеля: 5 м;Вес: 6,35 кг;Гарантийный срок: 1 год;---Комплектация:Очиститель высокого давления;Шланг высоконапорный - 5 м;Пистолет;Удлинительная насадка;Веерная фреза;Грязевая фреза;Инструмент для чистки форсунки;Входной минифильтр-коннектор 1/2\";Пеногенератор;---Совместимые товары:DGWT900011 Пистолет распылительный;DGWT900012 Трубка струйная;DGWT900013 Распылительная насадка веерная (150 бар макс);DGWT900015 Грязевая фреза;DGWT900016 Пеногенератор активный;DGWT900017 Комплект для самовсасывания;DGWT900018 Шланг напорный 5 м;---","rating":4.33,"ratingCount":27,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":18,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a91-0569-a3d2-b06b-b0048d294ead","slug":"komplekt-dlya-samovsasivaniya-dlya-ochistitelya-visokogo-davleniya-dgm-dgwt900017","name":"Комплект для самовсасывания для очистителя высокого давления DGM (DGWT900017)","attributes":[],"reviewsCount":0,"offersCount":0,"price":522,"priceFrom":522,"priceTo":522,"images":["/images/ee/c1/94/36/db491dc4.png"],"hit":null,"description":"Комплект для самовсасывания для очистителя высокого давления DGM (DGWT900017)","rating":4.5,"ratingCount":18,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":9,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a91-056e-e44e-ce49-06da2ecfeb10","slug":"ochistitel-visokogo-davleniya-dgm-water-140-1.65-kvt-135-bar-420-l-ch-samovsasivanie-aktivniy-penogenerator-dgwt140001-dgwt140001","name":"Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001) (DGWT140001)","attributes":[],"reviewsCount":0,"offersCount":0,"price":7430,"priceFrom":7430,"priceTo":7430,"images":["/images/e8/15/0f/3a/39469d79.png"],"hit":null,"description":"Очиститель высокого давления с артикулом 101350806851 из серии \"\" производства \"DGM\" можно купить у нас по цене 7430 рублей в Москве. Очиститель высокого давления DGM Water 140 (1 Товар с кодом 111350806851 промаркировано штрих-кодом 5993112891435","rating":4.29,"ratingCount":27,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":19,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a91-0571-3fa7-6567-ea95bdc1dcf8","slug":"dgm-ochistitel-visokogo-davleniya-water-140","name":"DGM Очиститель высокого давления Water 140","attributes":[],"reviewsCount":0,"offersCount":0,"price":8530,"priceFrom":8530,"priceTo":8530,"images":["/images/bc/c7/c6/cc/9438c137.png"],"hit":null,"description":"Очиститель высокого давления DGM Water 140 (1.65 кВт, 135 бар, 420 л/ч, самовсасывание, активный пеногенератор) (DGWT140001)","rating":4.47,"ratingCount":17,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":9,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a91-0580-208d-c6b7-423e9838a063","slug":"moyka-visokogo-davleniya-dgm-water-140-dgwt140001-v-moskve","name":"Мойка высокого давления DGM Water 140 (DGWT140001) в Москве","attributes":[],"reviewsCount":0,"offersCount":0,"price":7400,"priceFrom":7400,"priceTo":7400,"images":["/images/e8/15/0f/3a/31469df9.png"],"hit":null,"description":"","rating":4.44,"ratingCount":29,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":16,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a91-310c-7d78-0ae2-5e0aa6cf2bb5","slug":"bitovaya-moyka-dgm-water-160-dgwt160001-cherno-zelenaya-4-nasadki","name":"Бытовая мойка DGM Water 160 DGWT160001 черно-зеленая 4 насадки","attributes":[],"reviewsCount":0,"offersCount":0,"price":10190,"priceFrom":10190,"priceTo":10190,"images":["/images/e1/cc/9a/33/8c6dcb32.png"],"hit":null,"description":"","rating":4.25,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":18,"fiveStarCount":6,"__typename":"Product"},{"id":"01904a91-310d-0421-8c42-8dad5e58c5c9","slug":"ochistitel-visokogo-davleniya-dgm-water-160","name":"Очиститель высокого давления DGM Water 160","attributes":[],"reviewsCount":0,"offersCount":0,"price":11099,"priceFrom":11099,"priceTo":11099,"images":["/images/bf/c8/87/9e/e8496434.png"],"hit":null,"description":"Преимущества: Алюминиевый корпус насоса высокого давления; Функция самовсасывания позволяет использовать очиститель без подключения к водопроводу; Веерная и грязевая форсунки в комплекте; Моющая щетка в комплекте; Встроенный бак для моющего средства; Пеногенератор для распыления моющей пены; Фильтр тонкой очистки в комплекте; --- Технические характеристики: Потребляемая мощность двигателя: 2200 Вт; Параметры сети электропитания: 220-240 В/50 Гц +/-15%; Максимально допустимое давление: 160 бар","rating":4.63,"ratingCount":30,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":19,"__typename":"Product"},{"id":"01904a91-310e-c259-55c4-e6e5b61a983a","slug":"ochistitel-visokogo-davleniya-dgm-water-160-2.20-kvt-160-bar-480-l-ch-samovsasivanie-vstroenniy-plus-aktivniy-penogenerator-shhetka-dgwt160001-dgwt160001","name":"Очиститель высокого давления DGM Water 160 (2.20 кВт, 160 бар, 480 л/ч, самовсасывание, встроенный + активный пеногенератор, щетка) (DGWT160001) (DGWT160001)","attributes":[],"reviewsCount":0,"offersCount":0,"price":10150,"priceFrom":10150,"priceTo":10150,"images":["/images/fe/cc/85/35/c952d432.png","/images/fe/cd/81/35/8a52dd30.png","/images/be/d4/d0/31/e34dd642.png","/images/bf/c8/c7/1e/e049e434.png","/images/df/84/fc/f2/e8c8e012.png","/images/ad/85/da/70/b60f856a.png","/images/ad/91/c7/e0/f61e9107.png","/images/ad/94/da/70/f60bf04a.png","/images/ca/4a/15/95/bd6e6a0d.png","/images/e9/91/c6/e0/d61e930f.png"],"hit":null,"description":"Преимущества: Алюминиевый корпус насоса высокого давления; Функция самовсасывания позволяет использовать очиститель без подключения к водопроводу; Веерная и грязевая форсунки в комплекте; Моющая щетка в комплекте; Встроенный бак для моющего средства; Пеногенератор для распыления моющей пены; Фильтр тонкой очистки в комплекте; --- Технические характеристики: Потребляемая мощность двигателя: 2200 Вт; Параметры сети электропитания: 220-240 В/50 Гц +/-15%; Максимально допустимое давление: 160 бар","rating":4.16,"ratingCount":18,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":3,"__typename":"Product"},{"id":"01904a91-3146-0b31-5481-cf561eba92f8","slug":"moyka-visokogo-davleniya-dgm-water-160","name":"Мойка высокого давления DGM Water 160","attributes":[],"reviewsCount":0,"offersCount":0,"price":8120,"priceFrom":8120,"priceTo":8120,"images":["/images/fa/2e/6a/99/4c19e638.png","/images/fa/96/e1/e3/c1c1612b.png","/images/bf/49/42/6a/5b66c09d.png","/images/bf/c8/c7/1e/e049e434.png","/images/e3/cc/9a/33/9c65ca23.png","/images/ae/37/5b/48/133698e6.png","/images/af/ca/c2/35/585b3626.png","/images/b0/9a/cd/63/6318cf6c.png","/images/b2/9b/cc/c7/63399918.png","/images/ee/79/0e/4b/258cb54c.png"],"hit":null,"description":"Основные характеристики: 160, Основные характеристики: 2200, Основные характеристики: 480 л/ч, Габариты: 51x32x25 см, Габариты: 8.55 кг, Другие функции и особенности: объем бака для моющего средства 0.75 л, встроенный, Другие функции и особенности: длина кабеля 5 м, Другие функции и особенности: есть, Другие функции и особенности: 50 °С, Другие функции и особенности: веерная фреза\u003cbr\u003e грязевая фреза\u003cbr\u003e, Другие функции и особенности: очиститель высокого давления\u003cbr\u003e шланг высоконапорный - 5 м\u003c","rating":4.42,"ratingCount":19,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":8,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-c1f3-9b4d-03ad-bfd35b04f2b4","name":"Насосы и комплектующие","slug":"nasosi-i-komplektuyushhie","image":"/images/b3/c3/99/2c/c932cccd.png","productsCount":32,"offersCount":32,"popularProduct":{"images":[],"__typename":"Product"},"products":[{"id":"01904a90-b364-2072-d1b1-08737ee15582","slug":"nasosnaya-stanciya-dgm-bp-1500-1500-vt-3600-l-ch-50-m-5-bar-maks-korpus-nasosa-chugun-bak-24-l","name":"Насосная станция DGM BP-1500 (1500 Вт, 3600 л/ч, 50 м, 5 бар макс, корпус насоса чугун, бак 24 л)","attributes":[],"reviewsCount":0,"offersCount":0,"price":10500,"priceFrom":10500,"priceTo":10500,"images":["/images/e1/94/96/58/c3e79a69.png"],"hit":null,"description":"","rating":4.39,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":14,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a90-b395-4165-2f40-217e77851c31","slug":"dgm-nasosnaya-stanciya-bp-1500","name":"DGM Насосная станция BP-1500","attributes":[{"name":"Артикул","value":"1409866"},{"name":"Бренд","value":"DGM"}],"reviewsCount":0,"offersCount":0,"price":9640,"priceFrom":9640,"priceTo":9640,"images":["/images/fb/ad/ac/1c/e0e19158.png"],"hit":null,"description":"DGM Насосная станция BP-1500","rating":4.53,"ratingCount":26,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":14,"__typename":"Product"},{"id":"01904a90-c2c9-816d-cae1-c4e2f2a9e819","slug":"dgm-nasosnaya-stanciya-bp-1100","name":"DGM Насосная станция BP-1100","attributes":[{"name":"Артикул","value":"1409867"},{"name":"Бренд","value":"DGM"}],"reviewsCount":0,"offersCount":0,"price":9030,"priceFrom":9030,"priceTo":9030,"images":[],"hit":null,"description":"DGM Насосная станция BP-1100","rating":4.62,"ratingCount":27,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":17,"__typename":"Product"},{"id":"01904a90-c2e9-7c39-f6ab-e3d5f953716c","slug":"nasosnaya-stanciya-dgm-dgm-bp-1100","name":"Насосная станция DGM DGM BP-1100","attributes":[],"reviewsCount":0,"offersCount":0,"price":10110,"priceFrom":10110,"priceTo":10110,"images":[],"hit":null,"description":"Насосная станция DGM BP-1100","rating":4.37,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":15,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a90-c2e9-cb96-7ef1-e62163e193fb","slug":"nasosnaya-stanciya-dgm-bp-1100-10","name":"Насосная станция DGM BP-1100 (*10)","attributes":[],"reviewsCount":0,"offersCount":0,"price":9290,"priceFrom":9290,"priceTo":9290,"images":["/images/f9/85/a4/de/d0e19368.png"],"hit":null,"description":"Насосная станция DGM BP-1100 - компактная и надежная система для водоснабжения загородных домов, коттеджей, участков. Предназначена для работы с чистой водой, для ирригации и орошения, для подачи воды к дому.","rating":4.4,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":13,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a90-c681-43ac-1090-d2224548955b","slug":"nasos-pogruzhnoy-dgm-bp-a111-dlya-gryaznoy-vodi-s-izmelchitelem","name":"Насос погружной DGM BP-A111 для грязной воды с измельчителем","attributes":[],"reviewsCount":0,"offersCount":0,"price":8390,"priceFrom":8390,"priceTo":8390,"images":["/images/b3/c3/99/2c/c932cccd.png"],"hit":null,"description":"Асинхронный двигатель с защитой от перегрузок. Автоматическое включение/выключение при помощи поплавкового выключателя. Чугунный корпус насоса. Нож-измельчитель. Крыльчатка разработана специально для загрязненной воды. *Пожалуйста, сверяйте информацию о товаре Насос погружной DGM BP-A111 для грязной воды с измельчителем с информацией на официальном сайте производителя. Внешний вид товара, его комплектация и характеристики могут изменяться производителем без предварительного уведомления. *Информация не является публичной офертой.","rating":4.4,"ratingCount":30,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":18,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a90-c682-81de-2710-ac15d6d0f6d0","slug":"drenazhniy-nasos-dgm-bp-a111","name":"Дренажный насос DGM BP-A111","attributes":[],"reviewsCount":0,"offersCount":0,"price":5900,"priceFrom":5900,"priceTo":5900,"images":["/images/e7/c3/92/69/9334c94e.png"],"hit":null,"description":"Купить Дренажный насос DGM BP-A111, Москва, Московская область Характеристики Высота подъема 10 м Глубина погружения 5 м Мощность 2000 Вт Производительность 300 л/мин Трубное соединение на фланец DN50 дюйм Тип дренажный для грязной воды Длина кабеля 8 м Материал корпуса чугун Вид погружной Забор воды нижний Защита от сухого хода поплавковый выключатель Мах температура жидкости 35 °С Соединитель в комплекте нет Для повышения давления нет Класс защиты IPX8 Напряжение 220 В Допустимый диаметр твердых частиц 26 мм Серия BP Конструкция центробежный Габариты 300х175х420 мм Гарантия 1 год Вес 16 кг","rating":4.4,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a90-c682-b903-3dd5-176a895a80bc","slug":"nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-s-izmelchitelem-2000-vt-18000-lch-pogruzhenie-do-5-m-art.-3920bccf94ec3","name":"Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 лч, погружение до 5 м) (art.: 3920bccf94ec3)","attributes":[],"reviewsCount":0,"offersCount":0,"price":9850,"priceFrom":9850,"priceTo":9850,"images":["/images/b3/c3/99/2c/c932cccd.png"],"hit":null,"description":"Цена: $9850.00 - Купить Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 лч, погружение до 5 м) и др. товары из категории Водоснабжение (Articul.: 3920bccf94ec3)","rating":4.65,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":8,"fiveStarCount":15,"__typename":"Product"},{"id":"01904a90-c682-d451-05a2-c869eaec291f","slug":"nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-s-izmelchitelem-2000-vt-18000-l-ch-pogruzhenie-do-5-m-bp-a111","name":"Насос погружной для грязной воды DGM BP-A111 с измельчителем (С измельчителем, 2000 Вт, 18000 л/ч, погружение до 5 м) (BP-A111)","attributes":[],"reviewsCount":0,"offersCount":0,"price":6800,"priceFrom":6800,"priceTo":6800,"images":["/images/8b/7d/a2/a2/f061a5e6.png","/images/ff/d0/83/98/943df025.png","/images/b6/e1/1e/63/d60ae11e.png","/images/e3/f0/93/5e/d02bda41.png"],"hit":null,"description":"Дренажный насос DGM BP-A111 применяется для перекачки загрязненных жидкостей с содержанием твердых частиц диаметром до 26 мм. Надежность. Корпус изготовлен из чугуна, благодаря чему отличается прочностью и устойчивостью к воздействию коррозии. Для защиты от работы вхолостую предусмотрен внешний поплавковый механизм, который отключает и включает насос в зависимости от уровня воды. Особенности DGM BP-A111: -удобная транспортировка. На корпусе предусмотрена рукоятка для удобства переноски агрегата.","rating":4.66,"ratingCount":15,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":5,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a90-c683-2909-879c-1d00d499de44","slug":"nasos-pogruzhnoy-dlya-gryaznoy-vodi-dgm-bp-a111-s-izmelchitelem-bp-a111","name":"Насос погружной для грязной воды DGM BP-A111 с измельчителем (BP-A111)","attributes":[],"reviewsCount":0,"offersCount":0,"price":7150,"priceFrom":7150,"priceTo":7150,"images":[],"hit":null,"description":"⭐⭐⭐Насос погружной для грязной воды DGM BP-A111 с измельчителем (BP-A111) по выгодной цене 7 150 ₽ — недорого заказать в Самаре в интернет-магазине Технарь.ру. Возможность купить в кредит, быстрая доставка 📦 и гарантия. Товары от производителя.","rating":4.61,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":8,"fiveStarCount":13,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-cad6-85c2-59d2-822be173fd4f","name":"Ручной инструмент","slug":"ruchnoy-instrument","image":"/images/ea/4b/59/db/478c8534.png","productsCount":29,"offersCount":29,"popularProduct":{"images":["/images/f6/42/5a/d2/428ce9af.png"],"__typename":"Product"},"products":[{"id":"01904a90-f47b-47bb-7899-9682a582d737","slug":"motokosa-dgm-bc-210-s-nozhom-i-golovkoy-2.1-kvt-kosilnaya-golovka-nozh-3-zub.-remen-odnolyamochniy-ves-7.3-kg","name":"Мотокоса DGM BC-210 с ножом и головкой (2.1 кВт, косильная головка, нож 3 зуб., ремень однолямочный, вес 7.3 кг)","attributes":[],"reviewsCount":0,"offersCount":0,"price":10905,"priceFrom":10905,"priceTo":10905,"images":["/images/bb/6a/4a/1a/da02ceec.png"],"hit":null,"description":"Мотокоса DGM BC-210 с ножом и головкой (2.1 кВт, косильная головка, нож 3 зуб., ремень однолямочный, вес 7.3 кг)","rating":4.57,"ratingCount":26,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":15,"__typename":"Product"},{"id":"01904a90-f47e-1e7c-6e78-57210949bf07","slug":"motokosa-dgm-bc-210-s-nozhom-i-golovkoy","name":"Мотокоса DGM BC-210 с ножом и головкой","attributes":[{"name":"Тип инструмента","value":"Все для сада"},{"name":"Ширина","value":"38 см"},{"name":"Вес","value":"7.7 кг"},{"name":"Высота","value":"165 см"},{"name":"Страна бренда","value":"Венгрия"},{"name":"Страна производства","value":"Китай"},{"name":"Вид инструмента","value":"Косы и триммеры"},{"name":"Длина","value":"30 см"},{"name":"Производитель","value":"DGM"}],"reviewsCount":0,"offersCount":0,"price":7530,"priceFrom":7530,"priceTo":7530,"images":["/images/f6/52/5a/da/628ca82f.png"],"hit":null,"description":"Вес, кг7,3Мощность2100Тип двигателяБензиновыйКоличество оборотов, об\\мин10000Уровень шума, Дб112Мощность двигателя, л.с.2,8Тип ручкиU-образная (велосипедная)Обьем топливного бака, л1,2Режущий элементЛеска/ножШирина скоса ножом, мм255Ширина скоса леской, мм430Расположение двигателяВерхнее","rating":4.59,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":9,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a90-f48e-dd23-9202-1a90343ecdf3","slug":"motokosa-dgm-bc-210-7-420-rub.-kupit-s-dostavkoy-v-moskve-i-regionah-rossii--etalon-bt","name":"Мотокоса DGM BC-210 (7 420 руб.) - купить с доставкой в Москве и регионах России | Эталон БТ","attributes":[{"name":"Мощность двигателя","value":"2.85 л.с., 2.1 кВт"},{"name":"Посадочный диаметр","value":"25.4 мм"},{"name":"Срок гарантии","value":"1 год"},{"name":"Толщина лески","value":"2.4 мм"},{"name":"Емкость бака","value":"1.2 л"},{"name":"Внешний диаметр","value":"10'"},{"name":"Плечевой ремень","value":"есть"},{"name":"Тип двигателя","value":"бензиновый"},{"name":"Тип стартера","value":"ручной"},{"name":"Уровень шума","value":"114 дБ"},{"name":"Антивибрационная система","value":"есть"},{"name":"Тактность двигателя","value":"двухтактный"},{"name":"Тип","value":"мотокоса"},{"name":"Ширина скашивания для лески","value":"430 мм"},{"name":"Вес","value":"7.3 кг"},{"name":"Максимальная частота вращения шпинделя","value":"10000 об/мин"},{"name":"Приводной вал","value":"жесткий"},{"name":"Режущий элемент","value":"леска, нож"},{"name":"Термозащита","value":"есть"},{"name":"Ширина скашивания для ножа","value":"255 мм"},{"name":"Защита от перегрева двигателя","value":"есть"}],"reviewsCount":0,"offersCount":0,"price":7420,"priceFrom":7420,"priceTo":7420,"images":["/images/f2/52/5a/da/720ee82b.png"],"hit":null,"description":"Мотокоса DGM BC-210 по цене 7 420 руб. купить в интернет-магазине Эталон БТ. Характеристики, отзывы, фото товара. Рассрочка, гарантия, доставка по всей России.","rating":4.53,"ratingCount":13,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":6,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a91-310e-4351-a9ff-2ab37cdc8e6e","slug":"https-nailbox.ru-catalog-dezinfektsiya-i-sterilizatsiya-kraft-pakety-kraft-pakety-universalnye-paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely","name":"https://nailbox.ru/catalog/dezinfektsiya-i-sterilizatsiya/kraft-pakety/kraft-pakety-universalnye/paket-bumazhnyy-samozapechatyvayushchiysya-dlya-sterilizatsii-dgm-steriguard-150kh250-mm-10-sht-bely/","attributes":[],"reviewsCount":0,"offersCount":0,"price":65,"priceFrom":65,"priceTo":65,"images":["/images/ed/69/92/96/9e924969.png"],"hit":null,"description":"","rating":4.36,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":16,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a91-8b98-c633-17b8-5137eb1a3a48","slug":"shhitok-svarshhika-dgm-dgm-dg1517-6","name":"Щиток сварщика DGM DGM DG1517-6","attributes":[],"reviewsCount":0,"offersCount":0,"price":970,"priceFrom":970,"priceTo":970,"images":[],"hit":null,"description":"Щиток сварщика с самозатемняющимся светофильтром V4100 DGM DG1517-6","rating":4.4,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a91-8bc3-74c7-f130-80c83c4541da","slug":"maska-svarshhika-so-svetofiltrom-v4000-dgm","name":"Маска сварщика со светофильтром, V4000, DGM","attributes":[],"reviewsCount":0,"offersCount":0,"price":1816,"priceFrom":1816,"priceTo":1816,"images":["/images/b9/e1/94/25/cb968d93.png"],"hit":null,"description":"Описание Маска сварочная хамелеон DGM V4000 предназначена для защиты глаз, головы и горла сварщика от излучения сварочной дуги при сварке (УФ- и ИК-излучений), а также от брызг расплавленного металла и искр. Использование щитка сварщика необходимо при проведении сварочных работ, а использование данного типа удобно, поскольку светофильтр автоматически затемняется при зажигании дуги. Щиток имеет четыре степени регулировки оголовья и два сенсора. Затемнение в светлом состоянии DIN 3, затемнение в темном состоянии DIN 11. Включение\\выключение полностью автоматическое. Питание осуществляется от солнечной батареи, замена батареи не требуется. Время срабатывания 1/10000 с. Время задержки 0.25 ~ 0.45 с. MIN сварочный ток TIG ≥20А/DC; ≥20А/AC. Применение: MIG; MAG/CO2; SMAW; TIG; MMA; воздушно-углеродная резка; импульсная сварка; плазменная сварка и резка. Сертификация ТРТС 019/2011, GS, DINGeprüft, CE, ANSI, CSA, AS/NZS.","rating":4.37,"ratingCount":27,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":17,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a91-8bc8-3f6e-8d9b-dd812bd146d5","slug":"maska-svarochnaya-hameleon-dgm-v7000-cherniy-v7000bl1","name":"Маска сварочная хамелеон DGM V7000 черный (V7000BL1)","attributes":[{"name":"Материал","value":"пластик"},{"name":"Модель","value":"V7000 черный (V7000BL1)"},{"name":"Скорость срабатывания светофильтра","value":"0,04 мс"},{"name":"Солнечная батарея","value":"есть"},{"name":"Степень затемнения в темном состоянии","value":"4-8 / 9-13 DIN"},{"name":"Регулировка степени затемнения","value":"внешняя"},{"name":"Ширина экрана","value":"63 мм"},{"name":"Степень затемнения в светлом состоянии","value":"3,5 DIN"},{"name":"Тип","value":"маска сварщика"},{"name":"Длина экрана","value":"104 мм"},{"name":"Количество сенсоров","value":"4 шт."},{"name":"Минимальный сварочный ток","value":"5 А"},{"name":"Оптический класс","value":"1/1/1/2"},{"name":"Размер фильтрующего элемента","value":"133x114x10 мм"},{"name":"Режим \"шлифовка\"","value":"есть"},{"name":"Цвет","value":"черный"},{"name":"Вес","value":"475 г"},{"name":"Вид светофильтра","value":"активный (хамелеон)"},{"name":"Температура эксплуатации","value":"0°C до +60°C"},{"name":"Элемент питания","value":"сменный"}],"reviewsCount":0,"offersCount":0,"price":3470,"priceFrom":3470,"priceTo":3470,"images":["/images/ef/e2/a0/69/d5259295.png","/images/f6/f8/09/c1/77608727.png","/images/b4/7c/90/a6/c953c69d.png","/images/bf/bd/c4/64/c087c613.png","/images/e2/0c/b5/62/e2feb0cc.png"],"hit":null,"description":"\u003cp\u003eМаска сварочная хамелеон DGM V7000 черный (V7000BL1) — модель профессиональной серии. Оснащена качественным светофильтром с 4 фотосенсорами, что позволяет проводить сварочные работы даже на небольших токах в режиме TIG. Оголовье с большим количеством настроек позволит настроить щиток под любого оператора. Защитное стекло в комплекте.\u003cbr /\u003e Преимущества:\u003cbr /\u003e – высокий оптический класс 1/1/1/2;\u003cbr /\u003e – 4 фоточувствительных сенсора;\u003cbr /\u003e – большая зона обзора 104х63 мм;\u003cbr /\u003e – плавная регулировка чувствительности;\u003cbr /\u003e – плавная регулировка времени задержки высветления после сварки;\u003cbr /\u003e – для всех типов сварки;\u003cbr /\u003e – оптимальный выбор для сварки TIG даже на малых токах;\u003cbr /\u003e – режим \"Шлифовка\";\u003cbr /\u003e – эластичный ударопрочный пластик;\u003cbr /\u003e – увеличенная площадь защиты области шеи, ушей, головы;\u003cbr /\u003e – сменная батарея CR2450.\u003c/p\u003e","rating":4.36,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":14,"fiveStarCount":8,"__typename":"Product"},{"id":"01904a91-a2d3-8a18-38c6-f4c38b2116e8","slug":"trimmer-dgm-bc-241-s-nozhom-i-golovkoy-2.4-kvt-kosilnaya-golovka-nozh-3-zub.-remen","name":"Триммер DGM BC-241 с ножом и головкой (2.4 кВт, косильная головка, нож 3 зуб., ремень)","attributes":[],"reviewsCount":0,"offersCount":0,"price":7500,"priceFrom":7500,"priceTo":7500,"images":["/images/eb/4b/49/d9/638cc534.png"],"hit":null,"description":"","rating":4.47,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":11,"__typename":"Product"},{"id":"01904a91-c97d-ef41-6faf-280c0e64b4d6","slug":"motokosa-dgm-bc-241s-s-razbornoy-shtangoy-2.4-kvt-razbornaya-shtanga-kosilnaya-golovka-nozh-3-zub-remen-odnolyamochniy-ves-7.3-kg-dg1509-6","name":"Мотокоса DGM BC-241S с разборной штангой (2.4 кВт, разборная штанга, косильная головка, нож 3 зуб, ремень однолямочный, вес 7.3 кг) (DG1509-6)","attributes":[],"reviewsCount":0,"offersCount":0,"price":9440,"priceFrom":9440,"priceTo":9440,"images":["/images/d6/f0/16/9a/b10fa92d.png"],"hit":null,"description":"Мотокоса с артикулом 101646739532 из серии \"\" производства \"DGM\" можно купить у нас по цене 9440 рублей в Москве. Мотокоса DGM BC-241S с разборной штангой (2 Товар с кодом 111646739532 промаркировано штрих-кодом 5991803861156","rating":4.54,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a91-c98f-3eb5-f9d9-cafbb74f510e","slug":"motokosa-benzinovaya-3.3-l.s.razemnaya-shtanganozh-3t73-kg.-dgm-bc-241","name":"Мотокоса бензиновая (3.3 л.с.,разъемная штанга,Нож 3Т,7,3 кг.) DGM BC-241","attributes":[],"reviewsCount":0,"offersCount":0,"price":5583,"priceFrom":5583,"priceTo":5583,"images":["/images/ea/4b/59/db/478c8534.png"],"hit":null,"description":"Описание \"Мотокоса DGM BC-241 имеет мощный двухтактный двигатель с системой воздушного охлаждения. Допустимый уровень шума 114 + 3 дБА. Удобный одноплечный ремень и эргономичные рукоятки позволяют оператору работать продолжительное время не уставая. Технические характеристики: Тип двигателя двухтактный, воздушного охлаждения Максимальная мощность двигателя (при 7500 об/мин) 2,4 кВт Максимальная частота вращения 9000-10000 об/мин Частота холостых оборотов 3000+10% об/мин;Объём топливного бака Леска d2,4 мм/2,5 м Нож 1,4x255 мм/3 лопасти Посадочная резьба под головку М10х1.25 Посадочный диаметр под нож 25.4 мм Размер ножа: 255x25.4x1,4 мм Диаметр рабочей зоны: нож: 255 мм леска: 430 мм Штанга: цельная 26мм Вал: 9 шлицов Ремень: одноплечный Масса нетто / брутто: 7,3 / 9,0 кг Топливная смесь: 1 (масло) Допустимый уровень шума: 114 + 3 дБА Допустимый уровень вибрации: 1,4+0,3 м/с10-2\"","rating":4.55,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":9,"fiveStarCount":11,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-c8c9-d106-858b-e4a5ac233d72","name":"Уход за ногтями","slug":"uhod-za-nogtyami","image":"/images/c5/e8/6a/87/32962f1b.png","productsCount":23,"offersCount":23,"popularProduct":{"images":["/images/ba/c7/c1/3c/67c138c6.png"],"__typename":"Product"},"products":[{"id":"01904a90-b738-b624-aacd-5ecebff0e1dc","slug":"dgm-steriguard-rulon-upakovochniy-ploskiy-100h200-m","name":"DGM Steriguard, Рулон упаковочный плоский 100х200 м","attributes":[],"reviewsCount":0,"offersCount":0,"price":2019,"priceFrom":2019,"priceTo":2019,"images":["/images/c5/e8/6a/87/32962f1b.png"],"hit":null,"description":"\u003cp\u003eДля стерилизации инструментов\u003c/p\u003e","rating":4.33,"ratingCount":12,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":8,"fiveStarCount":4,"__typename":"Product"},{"id":"01904a90-f6d3-5396-47eb-02b6d280d45a","slug":"dgm-steriguard-indikator-kontrolya-sterilizacii-klass-4-tip-a-180s-60-min-1000-sht","name":"DGM Steriguard, индикатор контроля стерилизации (класс 4 тип А, 180°С-60 мин), 1000 шт","attributes":[],"reviewsCount":0,"offersCount":0,"price":1921,"priceFrom":1921,"priceTo":1921,"images":["/images/e6/63/86/9c/99616967.png"],"hit":null,"description":"Индикатор контроля стерилизации (класс 4 тип А, 180°С-60 мин) бренда DGM Steriguard в количестве 1000 шт. Одноразовые химические индикаторы для контроля процесса стерилизации предназначены для контроля цикла воздушной стерилизации по режиму 180°С/60 минут внутри (в центре) стерилизационных упаковок с изделиями/снаружи стерилизационных упаковок. Индикаторы производятся в листах с точечной перфорацией между индикаторами, на лицевой стороне которых нанесена индикаторная метка, необратимо меняющая цвет при обеспечении определенных условий воздействия стерилизующего агента в процессе цикла стерилизации. Данные индикаторы соответствуют классу 4 по ГОСТ ISO 11140-1-2011. Их обратная сторона имеет липкий слой для фиксации в месте контроля и документах архива закрыта защитной бумагой. Индикаторы помещены в упаковку с целью защиты нанесенного на подложку химического агента от попадания прямых солнечных лучей, резких температурных перепадов, механических воздействий. В упаковке 1000 тестов и журнал учета.","rating":4.36,"ratingCount":19,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a90-f6e1-ac8f-28bb-52a8ebce19ba","slug":"indikator-dgm-dlya-vozdushnoy-sterilizacii-klass-4-tip","name":"Индикатор DGM для воздушной стерилизации класс 4 тип","attributes":[],"reviewsCount":0,"offersCount":0,"price":4,"priceFrom":4,"priceTo":4,"images":[],"hit":null,"description":"Индикатор DGM для воздушной стерилизации класс 4 тип","rating":4.56,"ratingCount":23,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a90-f731-b37e-2830-9607b3c7c3dd","slug":"indikator-himicheskiy-odnorazoviy-dgm-steriguard-klass-4-tip-180-1chas-1000sht","name":"Индикатор химический одноразовый DGM Steriguard класс 4 тип: 180 *\\1час (1000шт)","attributes":[],"reviewsCount":0,"offersCount":0,"price":855,"priceFrom":855,"priceTo":855,"images":["/images/de/4a/ad/a5/5552e05c.png"],"hit":null,"description":"Индикатор химический одноразовый DGM Steriguard класс 4 тип: 180 град. С - 60 мин. (1000шт)","rating":4.52,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":11,"__typename":"Product"},{"id":"01904a90-f75b-2d27-b8be-3675d0bc7f8d","slug":"indikator-dlya-kontrolya-processa-sterilizacii-dgm-steriguard-100sht","name":"Индикатор для контроля процесса стерилизации DGM Steriguard 100шт","attributes":[{"name":"Страна происхождения","value":"Россия"},{"name":"Товар","value":"Дезинфекция и стерилизация"},{"name":"Бренд","value":"DGM Steriguard"},{"name":"Вес","value":"150 г"},{"name":"Материал","value":"Бумага"}],"reviewsCount":0,"offersCount":0,"price":92,"priceFrom":92,"priceTo":92,"images":["/images/bf/3f/c0/c0/c0782fc3.png"],"hit":null,"description":"Индикатор химический одноразовый для контроля процесса воздушной стерилизации марки DGM Steriguard класс 4 тип: 180 град. С - 60 мин. В упаковке 100 штук.","rating":4.39,"ratingCount":28,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":17,"fiveStarCount":11,"__typename":"Product"},{"id":"01904a91-04ec-79a9-88f0-5f729d11a235","slug":"dgm-steriguard-indikator-kontrolya-sterilizacii-klass-4-tip-v2-132s-20-min-1000-sht","name":"DGM Steriguard, индикатор контроля стерилизации (класс 4 тип В2, 132°С-20 мин), 1000 шт","attributes":[],"reviewsCount":0,"offersCount":0,"price":948,"priceFrom":948,"priceTo":948,"images":["/images/9b/ce/64/31/90cecf83.png"],"hit":null,"description":"Индикатор химический одноразовый для контроля процесса паровой стерилизации марки DGM Steriguard класс 4 тип В2 для использования снаружи упаковки: 120 град. С - 45 мин., 132 град. С - 20 мин.","rating":4.29,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":17,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a91-0591-1c0e-a06b-00f094c4070b","slug":"dgm-steriguard-indikatori-dlya-kontrolya-processa-vozdushnoy-sterilizacii-klass-4-180s-60-min.-100-sht.","name":"DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации (класс 4, 180С-60 мин., 100 шт.)","attributes":[],"reviewsCount":0,"offersCount":0,"price":150,"priceFrom":150,"priceTo":150,"images":["/images/f2/b0/cc/64/8a84fafa.png","/images/ee/62/84/9d/9a705b63.png"],"hit":null,"description":"DGM Steriguard, Индикаторы для контроля процесса воздушной стерилизации (класс 4, 180С-60 мин., 100 шт.)","rating":4.15,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":17,"fiveStarCount":3,"__typename":"Product"},{"id":"01904a91-1f6a-55b4-acf1-32e2d493ff0f","slug":"dgm-steriguard-kraft-paket-dlya-sterilizacii-75150-mm-100-sht","name":"DGM Steriguard, крафт-пакет для стерилизации (75*150 мм), 100 шт","attributes":[],"reviewsCount":0,"offersCount":0,"price":203,"priceFrom":203,"priceTo":203,"images":["/images/e1/4d/9a/92/9e38cd69.png"],"hit":null,"description":"Пакеты предназначены для радиационной, газовой, воздушной и паровой стерилизации инструментов и медицинских изделий для их сохранения в стерильном состоянии после стерилизации при самозапечатывании сроком на 1 год.","rating":4.55,"ratingCount":18,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":8,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a91-eb1a-e3df-0878-14dc0962940c","slug":"sterilizuyushhee-sredstvo-dgm-steriguard-250ml.-sredstvo-prednaznacheno-dlya-sterilizacii-izdeliy-medicinskogo-naznacheniya-i-razlichnih-materialov-vklyuchaya-endoskopi-pri-ispolzovanii-v-plazmennom-nizkotem","name":"Стерилизующее средство DGM Steriguard, 250мл. Средство предназначено для стерилизации изделий медицинского назначения и различных материалов (включая эндоскопы) при использовании в плазменном низкотем","attributes":[],"reviewsCount":0,"offersCount":0,"price":15150,"priceFrom":15150,"priceTo":15150,"images":[],"hit":null,"description":"Контрактная цена закупки: 15 150 рублейКол-во: 4Единица измерения: шт (796)Общая сумма: 60 602 рублейСравните цены Номер контракта: 139400107Дата публикации: 20-05-2019Регион: Кемеровская область (посмотрите новые тендеры и закупки региона Кемеровской области) ФЗ-44 Раздел: Бумага, издательствоЗакон: ФЗ-44Заказчик закупки: муниципальное лечебно - профилактическое учреждение \"Городская клиническая больница N 5\" (информация о заказчике муниципальное лечебно - профилактическое учреждение \"Городская клиническая больница N 5\" \u003e\u003e)Код: 32.50.13.190 Инструменты и приспособления, применяемые в медицинских целях, прочие, не включенные в другие группировкиПоставщик: Общество с ограниченной ответственностью \"Асептика\"\"Контактная информация доступна только подписчикам портала","rating":4.45,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":13,"fiveStarCount":11,"__typename":"Product"},{"id":"01904a92-7113-4ebf-a607-d14852690d7a","slug":"paket-500x670-mm-100-sht-dlya-sterilizacii-usilenniy-kombinirovanniy-dgm","name":"Пакет 500x670 мм 100 шт для стерилизации усиленный комбинированный DGM","attributes":[],"reviewsCount":0,"offersCount":0,"price":65800,"priceFrom":65800,"priceTo":65800,"images":["/images/af/1d/d5/3a/2ac02ec5.png"],"hit":null,"description":"\u003cp\u003e\u003c/p\u003e \u003cul\u003e \u003cli\u003e500x670 мм\u003c/li\u003e \u003cli\u003e100 шт\u003c/li\u003e \u003c/ul\u003e","rating":4.34,"ratingCount":29,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":19,"fiveStarCount":10,"__typename":"Product"}],"__typename":"Category"},{"id":"01904a97-cb0e-0617-7905-79af0ed089bd","name":"Приготовление блюд","slug":"prigotovlenie-blyud","image":"/images/b0/4b/4c/74/b4379b33.png","productsCount":16,"offersCount":16,"popularProduct":{"images":[],"__typename":"Product"},"products":[{"id":"01904a90-f731-9acb-4cbb-bf31ec295566","slug":"indikator-testa-bovi-dik-kontrolniy-paket-ukladka-razoviy-dlya-medicinskoy-parovoy-sterilizacii-marki-dgm-steriguard","name":"Индикатор теста Бови-Дик контрольный (пакет укладка разовый) для медицинской паровой стерилизации марки \"DGM Steriguard\"","attributes":[],"reviewsCount":0,"offersCount":0,"price":251,"priceFrom":251,"priceTo":251,"images":[],"hit":null,"description":"","rating":4.51,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a91-5e56-e154-cbf9-3a70118b55cb","slug":"dgm-80-vertikalniy-parovoy-sterilizator-gorizontalniy-75-litrov","name":"DGM 80 — вертикальный паровой стерилизатор горизонтальный (75 литров)","attributes":[{"name":"Габариты (глубина x ширина x высота)","value":"510x500x1400 мм"},{"name":"Объем камеры","value":"75 литров"},{"name":"Размер камеры","value":"Ø365 h655 мм"},{"name":"Температура стерилизации","value":"105-132 °C"},{"name":"Электропитание","value":"220/50 В/Гц"},{"name":"Энергопотребление","value":"3,5 кВт"},{"name":"Вес","value":"85 кг"}],"reviewsCount":0,"offersCount":0,"price":120000,"priceFrom":120000,"priceTo":120000,"images":["/images/b0/4b/4c/74/b4379b33.png"],"hit":null,"description":"Вертикальный паровой стерилизатор DGM-80 предназначен для стерилизации жидкостей, стеклянных изделий и микробиологических растворов. Рекомендуется для больниц, амбулаторных клиник, аптек, офтальмологических и стоматологических кабинетов, а также для медицинских и научных лабораторий. Особенности автоклава DGM 80 : Микропроцессорное управление Крышка сдвигается вбок, автоматическая блокировка Автоматический контроль уровня воды в испарителе Отображение параметров процесса (температура в камере и время, оставшееся до окончания процесса) на экране Удаление воздуха из камеры паровым вытеснением Выключение питания электрического нагревателя при открытой крышке и в случае избыточного давления в камере Плавная регулировка параметров Характеристики Объем камеры 75 литров Размер камеры Ø365 h655 мм Габариты (глубина x ширина x высота) 510x500x1400 мм Вес 85 кг Температура стерилизации 105-132 °C Электропитание 220/50 В/Гц Энергопотребление 3,5 кВт","rating":4.53,"ratingCount":26,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":14,"__typename":"Product"},{"id":"01904a91-ba5e-f17b-7f4c-49ee69f3db77","slug":"kombi-parovarka-miele-dgm-7440-obsw","name":"Комби-пароварка Miele DGM 7440 OBSW","attributes":[],"reviewsCount":0,"offersCount":0,"price":473000,"priceFrom":473000,"priceTo":473000,"images":["/images/ea/cb/c3/35/3432caca.png"],"hit":null,"description":"Комби-пароварка Miele DGM 7440 OBSW","rating":4.5,"ratingCount":20,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a91-ba6f-3070-c93b-34f5e873b852","slug":"parovarka-s-svch-dgm-7440-obsw","name":"Пароварка с СВЧ DGM 7440 OBSW","attributes":[],"reviewsCount":0,"offersCount":0,"price":407601,"priceFrom":407601,"priceTo":407601,"images":["/images/df/c2/c1/36/4d4ac98d.png"],"hit":null,"description":"Тип управления: СенсорныйОбъем рабочей камеры: 40 лРегулировка температуры пароварки: 40-100 °СУровней для противня: 4Гарантия: 2 годаПроизводство: ГерманияВ наличии: 4 шт.","rating":4.45,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":12,"fiveStarCount":10,"__typename":"Product"},{"id":"01904a91-baa4-af20-b1be-95202d12d10e","slug":"parovarka-s-svch-miele-dgm-7440-edst-clst-nerzhaveyushhaya-stal-bt-premium.ru","name":"Пароварка с СВЧ Miele DGM 7440 EDST/CLST (Нержавеющая сталь) - БТ Премиум.ру","attributes":[],"reviewsCount":0,"offersCount":0,"price":365000,"priceFrom":365000,"priceTo":365000,"images":[],"hit":null,"description":"Пароварка с СВЧ Miele DGM7440 EDST/CLST. Объем 40 л, сенсорное управление, подача пара DualSteam, автопрограммы и свои настройки. Цвет нержавеющая сталь","rating":4.54,"ratingCount":22,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":10,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a91-bad2-89aa-605b-f0e8210df528","slug":"vstraivaemaya-parovarka-miele-dgm-7440-obsw","name":"Встраиваемая пароварка Miele DGM 7440 OBSW","attributes":[],"reviewsCount":0,"offersCount":0,"price":414810,"priceFrom":414810,"priceTo":414810,"images":["/images/fe/c3/c1/35/85cc898d.png","/images/fe/c3/c1/35/8dc8898d.png","/images/bf/33/b8/2d/c06bc891.png","/images/ea/4d/95/33/959c9531.png"],"hit":null,"description":"Встраиваемая пароварка Miele DGM 7440 OBSW","rating":4.54,"ratingCount":24,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":11,"fiveStarCount":13,"__typename":"Product"},{"id":"01904a91-bad3-be47-48cf-08d9f2981298","slug":"parovarka-s-svch-miele-dgm-7440-obsidian-black","name":"Пароварка с СВЧ Miele DGM 7440 Obsidian black","attributes":[],"reviewsCount":0,"offersCount":0,"price":419000,"priceFrom":419000,"priceTo":419000,"images":["/images/fe/c3/c1/36/c8cac88d.png"],"hit":null,"description":"Пароварка с СВЧ Miele DGM7440 OBSW имеет стильный вид. Чтобы привлекательность устройства сохранялась дольше, на фронтальную часть нанесено покрытие CleanGlass. Оно не даёт оставлять белёсый налёт от пара, а также следы от пальцев. Камера из нержавеющей стали с рельефным покрытием защищена от коррозии и легко моется благодаря покрытию PerfectClean, которое помогает поддерживать гигиену. Особенности В модели Миле DGM7440 OBSW доступно приготовление в режимах СВЧ-печи, пароварки, а также с использованием в одном процессе влажного воздуха и микроволн. Так вы сможете сократить время и сохранить неизменное качество. Технология двойного нагнетания пара DualSteam равномерно распределяет его внутри рабочей камеры, а схожая по действию Quick\u0026Gentle работает аналогичным образом с микроволнами. Навигация осуществляется через сенсорную панель управления DirectSensor. Она имеет несколько чувствительных к прикосновению кнопок и четырёстрочный текстовый дисплей. Инновации Опция QuickStart работает на максимальной мощности в течение 30 секунд, чтобы разогреть напитки и еду. Автоменю само выставит температуру, время и этапы приготовления, значительно облегчая настройки. Также вы можете внести до 20 своих избранных рецептов в память прибора. Функция поддержания тепла поможет оставить приготовленные блюда тёплыми до сервировки на стол. Во время настроек на дисплей выводятся подсказки, например, рекомендуемой температуры. Специальная кнопка для попкорна вынесена на панель управления. Приготовить любимое блюдо станет проще.","rating":4.42,"ratingCount":28,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":16,"fiveStarCount":12,"__typename":"Product"},{"id":"01904a91-ce65-eb72-ccec-1edf861bf6ee","slug":"parovarka-miele-dgm-7440-edst-clst-nerzhaveyushhaya-stal","name":"Пароварка Miele DGM 7440 EDST/CLST Нержавеющая сталь","attributes":[],"reviewsCount":0,"offersCount":0,"price":308986,"priceFrom":308986,"priceTo":308986,"images":["/images/fa/ca/81/25/a5dabe05.png"],"hit":null,"description":"Пароварка Miele DGM 7440 EDST/CLST Нержавеющая сталь — купить по выгодной цене в официальном интернет-магазине ХРОМ. Доставка по всей России. Профессиональные консультации технических специалистов помогут быстро разобраться в товаре. Прямые контракты с производителями гарантируют высокое качество продукции и сервиса. Короткие сроки и бережная доставка сделают покупки удобными и приятными.","rating":4.5,"ratingCount":14,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":7,"fiveStarCount":7,"__typename":"Product"},{"id":"01904a91-ce6a-7db3-08e6-b1812757b6db","slug":"kombi-parovarka-miele-dgm-7440-edst-clst","name":"Комби-пароварка Miele DGM 7440 EDST/CLST","attributes":[],"reviewsCount":0,"offersCount":0,"price":434500,"priceFrom":434500,"priceTo":434500,"images":["/images/fe/ca/c1/25/25254afa.png"],"hit":null,"description":"Комби-пароварка Miele DGM 7440 EDST/CLST","rating":4.36,"ratingCount":25,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":16,"fiveStarCount":9,"__typename":"Product"},{"id":"01904a91-ce70-7e92-7055-4bcbe7e4b7bd","slug":"parovarka-s-svch-dgm-7440-edst-clst","name":"Пароварка с СВЧ DGM 7440 EDST/CLST","attributes":[],"reviewsCount":0,"offersCount":0,"price":392506,"priceFrom":392506,"priceTo":392506,"images":["/images/df/ca/41/25/04cadadd.png"],"hit":null,"description":"Тип управления: СенсорныйОбъем рабочей камеры: 40 лРегулировка температуры пароварки: 40-100 °СУровней для противня: 4Гарантия: 2 годаПроизводство: ГерманияВ наличии: 3 шт.","rating":4.61,"ratingCount":21,"discount":0,"oneStarCount":0,"twoStarCount":0,"threeStarCount":0,"fourStarCount":8,"fiveStarCount":13,"__typename":"Product"}],"__typename":"Category"}],"tags":[{"id":"01904a90-7e52-1523-30fa-b8c9c22ca05b","text":"компрессор dgm","url":"/t/kompressor-dgm","__typename":"Tag"},{"id":"01904a90-7e55-0459-091c-d35e98003e9a","text":"dgm ac","url":"/t/dgm-ac","__typename":"Tag"},{"id":"01904a90-7e55-ae8a-9b5e-31df0615a988","text":"dgm инструмент","url":"/t/dgm-instrument","__typename":"Tag"},{"id":"01904a90-7e58-4a14-8122-1ad352b89778","text":"dgm запчасти","url":"/t/dgm-zapchasti","__typename":"Tag"},{"id":"01904a90-7e58-4b5b-7d40-4fa3e82abfb7","text":"dgm 400","url":"/t/dgm-400","__typename":"Tag"},{"id":"01904a90-7e58-73b7-e780-c7f1b1ad165d","text":"dgm 1500","url":"/t/dgm-1500","__typename":"Tag"},{"id":"01904a90-7e59-d8c4-0924-128206403d18","text":"плазменные стерилизаторы dgm","url":"/t/plazmennie-sterilizatori-dgm","__typename":"Tag"},{"id":"01904a90-7e5a-1f32-2b3c-53ebe24a8f9c","text":"dgm 200","url":"/t/dgm-200","__typename":"Tag"},{"id":"01904a90-7e5a-6329-0f97-9da4136ca385","text":"насос садовый dgm 05d","url":"/t/nasos-sadoviy-dgm-05d","__typename":"Tag"},{"id":"01904a90-7e5a-6b89-32ca-e6093df18774","text":"dgm 1200","url":"/t/dgm-1200","__typename":"Tag"},{"id":"01904a90-7e5b-0883-f099-629e3fbb18c3","text":"dgm steriguard средство","url":"/t/dgm-steriguard-sredstvo","__typename":"Tag"},{"id":"01904a90-7e5c-0f42-b922-ae8683bbce3a","text":"dgm стерилизация","url":"/t/dgm-sterilizaciya","__typename":"Tag"},{"id":"01904a90-7e5c-cec1-214b-6b3c40ba2758","text":"dgm ac 450f","url":"/t/dgm-ac-450f","__typename":"Tag"},{"id":"01904a90-7e5c-dbc4-cb68-ae4c66719b79","text":"насосная станция dgm","url":"/t/nasosnaya-stanciya-dgm","__typename":"Tag"},{"id":"01904a90-7e5d-edca-af4e-f4f92fd384f1","text":"dgm 1","url":"/t/dgm-1","__typename":"Tag"},{"id":"01904a90-7e5e-cea0-b52f-c7ad1d5f0742","text":"dgm","url":"/t/dgm","__typename":"Tag"},{"id":"01904a90-7e5f-9f09-5534-a6870da34b87","text":"индикатор dgm","url":"/t/indikator-dgm","__typename":"Tag"},{"id":"01904a90-7e60-b3d5-de0f-43af64b2236a","text":"dgm 450f","url":"/t/dgm-450f","__typename":"Tag"},{"id":"01904a90-7e61-6893-51c3-4ce253b6c536","text":"материал dgm","url":"/t/material-dgm","__typename":"Tag"},{"id":"01904a90-7e61-c870-2edc-beac21bb30a6","text":"dgm steriguard класс 4","url":"/t/dgm-steriguard-klass-4","__typename":"Tag"}],"getVideos":{"items":[{"id":"-5_W-YtyLzY","title":"Ротационная система DGM для нанесения шрифта Брайля на картонную упаковку.","thumb":"/thumbs/d3/bf/4f/6a/22ce7400.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"-DuAqUpuQ9U","title":"GAC GS8 – КЛАССИЧЕСКИЙ полноприводный КРОССОВЕР / НЕДОСТАТКИ тоже ЕСТЬ","thumb":"/thumbs/aa/a9/6d/ce/26e8b492.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"-JCCa20YTzo","title":"DGM T-Folder 2000 carton pasting machine","thumb":"/thumbs/eb/37/e2/c1/c1819dc6.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"-_F-dnhjAM0","title":"Уценка. Бензиновый опрыскиватель TCH ZZ-999","thumb":"/thumbs/9b/99/74/cc/3133cc33.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"-llWNwE9KZY","title":"НАТУРАЛЬНЫЕ КАМНИ. Обзор нитей 19.07.24. Заказ в телеграмм или ватцапп 89111602266","thumb":"/thumbs/a7/1f/c8/2f/54b14a3a.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"-uChxi2y0is","title":"Недорогая защитная сварочная маска DGM V4000.Основные вопросы за 5 минут.","thumb":"/thumbs/cf/56/c8/47/847e6338.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"-yOIyGkxE3w","title":"DGM - \"Ghost of Insanity\" feat. Tom Englund of Evergrey (Official Lyric Video)","thumb":"/thumbs/97/d3/5a/2c/34b142cf.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"04GU0ZhxjRc","title":"Ремонт стерилизатора","thumb":"/thumbs/b3/ef/8c/99/2c243393.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"0NphFeluMRM","title":"Зарядное устройство АКБ Intertool AT-3012 6A Обзор","thumb":"/thumbs/94/d8/cf/90/cf943369.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"0TheI-aDefs","title":"DGM - \"To The Core\" - Official Music Video","thumb":"/thumbs/d7/d1/e8/a2/584a9657.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"0b4cGvCwUw8","title":"Переработка ПП биг бэгов -- Прибыльный безнесс","thumb":"/thumbs/88/a4/77/df/20ccaf8c.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"0ed0bYOKmsQ","title":"Motor de corredera DGM AC 600","thumb":"/thumbs/ac/3e/fa/66/5abc8128.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"0lFNURGmF7M","title":"Плазменный стерилизатор HiCare A-01","thumb":"/thumbs/d8/80/e3/4b/5f7705b1.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"0zUUM_RtAlI","title":"Фальцевально-склеивающая машина DGM MEGAFOLD 1650","thumb":"/thumbs/93/74/6d/87/723d3223.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"11BhldM8h78","title":"sghgdvhjafgjmDghd. dbjfcltg-dgm","thumb":"/thumbs/a4/99/33/e6/3333cc33.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"1A2UGQROfT4","title":"ЭТОТ USB МИКРОФОН СТОИТ $45? Обзор Maono Gamerwave DGM20","thumb":"/thumbs/97/9f/1d/82/3a59d01b.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"1GGnixL0tSs","title":"DGM 360 interview with spatial sound test","thumb":"/thumbs/fa/a8/03/ff/a0bf5401.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"1OuNBXSl5D0","title":"DGM Megafold 1650SL Фальцевально-склеивающая машина для работы с гофрокартоном","thumb":"/thumbs/95/75/ca/37/a40bd986.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"1YAcEAGy7UM","title":"LEZUEZ Ft DGM Dinero - Te Duele (Video Oficial)","thumb":"/thumbs/ed/0d/ec/a1/934ccc53.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"1hnCRjBOzsY","title":"Автоматическое промывочное устройство для очистки и обработки каналов гибких эндоскопов Scope Buddy","thumb":"/thumbs/ed/84/96/33/92ceca69.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"1lhVug5oSqE","title":"HDMONA -  ድግም ድግም  ብ ዳናይት ዮውሃንስ ft ሳሌም ጎይትኦም Dgm Dgm -  New Eritrean Music 2023","thumb":"/thumbs/ae/26/dd/91/4d3cc2b4.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"1ruRw0QdNH0","title":"Вбудована мікрохвильова піч пароварка 2в1 Miele DGM 6401","thumb":"/thumbs/8f/21/da/ad/41b4c7d8.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"1wfTP_cRtXQ","title":"Датчик реле давления Kromschroder DG500U-3 (84447550)","thumb":"/thumbs/9a/cc/b5/4b/c832eb85.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"240x2o8o_1k","title":"Мойка высокого давления Даджет AquaGun","thumb":"/thumbs/dc/9a/31/64/673364da.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"28a31sThtEk","title":"Пакет комбинированный для стерилизации (100 шт) - Roysswood","thumb":"/thumbs/d9/58/33/99/33393399.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"2Dxofy0Nehk","title":"\"ЭПСМ\" MMC GX50 - продан","thumb":"/thumbs/b4/b1/b8/b8/c35ed891.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"2EwZFUX-C9k","title":"Демонстрация продукта: Орбитальная шлифовальная машина Flex ORE 5 150 EC","thumb":"/thumbs/9c/d2/72/17/2de0666d.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"2IFvwvIIlOI","title":"Дезинфекция стиральной машины)","thumb":"/thumbs/9b/f3/66/32/199899c3.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"2ZwMwZAJhaw","title":"Делаем газ из углерода шин (технического углерода) на газогенераторе с паром","thumb":"/thumbs/99/98/6c/33/93f63943.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"},{"id":"2lBZBmUer9k","title":"Цанговая державка.","thumb":"/thumbs/ff/ce/4e/6c/205035e4.png","createdAt":"0001-01-01 00:00:00 +0000 UTC","__typename":"Video"}],"__typename":"Videos"},"getTopCityList":[{"name":"Москва","slug":"moskva","__typename":"GeoWithDomainSchema"},{"name":"Санкт-Петербург","slug":"sankt-peterburg","__typename":"GeoWithDomainSchema"},{"name":"Новосибирск","slug":"novosibirsk","__typename":"GeoWithDomainSchema"},{"name":"Екатеринбург","slug":"ekaterinburg","__typename":"GeoWithDomainSchema"},{"name":"Казань","slug":"kazan","__typename":"GeoWithDomainSchema"},{"name":"Нижний Новгород","slug":"nizhniy-novgorod","__typename":"GeoWithDomainSchema"},{"name":"Челябинск","slug":"chelyabinsk","__typename":"GeoWithDomainSchema"},{"name":"Самара","slug":"samara","__typename":"GeoWithDomainSchema"},{"name":"Омск","slug":"omsk","__typename":"GeoWithDomainSchema"},{"name":"Ростов-на-Дону","slug":"rostov-na-donu","__typename":"GeoWithDomainSchema"},{"name":"Уфа","slug":"ufa","__typename":"GeoWithDomainSchema"},{"name":"Красноярск","slug":"krasnoyarsk","__typename":"GeoWithDomainSchema"},{"name":"Воронеж","slug":"voronezh","__typename":"GeoWithDomainSchema"},{"name":"Пермь","slug":"perm","__typename":"GeoWithDomainSchema"},{"name":"Волгоград","slug":"volgograd","__typename":"GeoWithDomainSchema"}],"getPopularKeywords":[{"slug":"dgm-plus-chto-plus-eto-plus-v-logistike","text":"dgm что это в логистике","__typename":"Keyword"},{"slug":"dgm-report-plus-chto-plus-eto-plus-v-logistike","text":"dgm report что это в логистике","__typename":"Keyword"},{"slug":"dgm-test-report-plus-chto-plus-eto","text":"dgm test report что это","__typename":"Keyword"},{"slug":"netbios-dgm-plus-chto-plus-eto","text":"netbios dgm что это","__typename":"Keyword"},{"slug":"sertifikat-dgm-kitay-plus-chto-plus-eto","text":"сертификат dgm китай что это","__typename":"Keyword"}],"externalRelink":[{"domain":"maxi-discount.ru","tags":[{"text":"автокресло maxi cosi","target_url":"/t/avtokreslo-maxi-cosi","__typename":"ExternalRelinkTag"},{"text":"автолюлька maxi cosi","target_url":"/t/avtolyulka-maxi-cosi","__typename":"ExternalRelinkTag"},{"text":"kinder maxi king","target_url":"/t/kinder-maxi-king","__typename":"ExternalRelinkTag"},{"text":"maxi cosi pebble","target_url":"/t/maxi-cosi-pebble","__typename":"ExternalRelinkTag"},{"text":"maxi","target_url":"/t/maxi","__typename":"ExternalRelinkTag"}],"__typename":"ExternalRelinkResponse"},{"domain":"gree-torg.ru","tags":[{"text":"кондиционер gree","target_url":"/t/kondicioner-gree","__typename":"ExternalRelinkTag"},{"text":"gree","target_url":"/t/gree","__typename":"ExternalRelinkTag"},{"text":"сплит система gree","target_url":"/t/split-sistema-gree","__typename":"ExternalRelinkTag"},{"text":"gree bora 09","target_url":"/t/gree-bora-09","__typename":"ExternalRelinkTag"},{"text":"gree gwh09aaaxa k3nna2a","target_url":"/t/gree-gwh09aaaxa-k3nna2a","__typename":"ExternalRelinkTag"}],"__typename":"ExternalRelinkResponse"},{"domain":"konigin-torg.ru","tags":[{"text":"konigin","target_url":"/t/konigin","__typename":"ExternalRelinkTag"},{"text":"вытяжку konigin","target_url":"/t/vityazhku-konigin","__typename":"ExternalRelinkTag"},{"text":"konigin canary 60","target_url":"/t/konigin-canary-60","__typename":"ExternalRelinkTag"},{"text":"угольный фильтр для вытяжки konigin","target_url":"/t/ugolniy-filtr-dlya-vityazhki-konigin","__typename":"ExternalRelinkTag"},{"text":"konigin herbarium","target_url":"/t/konigin-herbarium","__typename":"ExternalRelinkTag"}],"__typename":"ExternalRelinkResponse"},{"domain":"tw-expert.ru","tags":[{"text":"mi tw earphones 2 basic","target_url":"/t/mi-tw-earphones-2-basic","__typename":"ExternalRelinkTag"},{"text":"yamaha tw 200","target_url":"/t/yamaha-tw-200","__typename":"ExternalRelinkTag"},{"text":"nike air max tw","target_url":"/t/nike-air-max-tw","__typename":"ExternalRelinkTag"},{"text":"беспроводные наушники gal tw 3500 green","target_url":"/t/besprovodnie-naushniki-gal-tw-3500-green","__typename":"ExternalRelinkTag"},{"text":"yamaha tw 225","target_url":"/t/yamaha-tw-225","__typename":"ExternalRelinkTag"}],"__typename":"ExternalRelinkResponse"}]},"headers":{"x-real-ip":"10.244.37.0","x-forwarded-for":"161.35.97.17, 10.244.37.0","host":"sergiev-posad.dgm-online.ru","x-forwarded-proto":"https","x-domain":"dgm-online.ru","connection":"close","if-modified-since":"Thu, 18 Jul 2024 03:22:55 GMT","if-none-match":"\"q1clx1zep1e9fq\"","x-request-id":"20a28df9e6ecd9b613b4e9befea99bd0","x-forwarded-host":"sergiev-posad.dgm-online.ru","x-forwarded-port":"443","x-forwarded-scheme":"https","x-scheme":"https","user-agent":"Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/55.0.2883.87 Safari/537.36","accept-encoding":"gzip, deflate","accept":"*/*"},"initialData":{"brand":{"id":"01904a90-8ade-33ec-af1d-2c8686750379","name":"DGM","__typename":"Brand"},"project":{"name":"DGM","title":null,"postfix":"online","domain":"dgm-online.ru","phone":"","updatedAt":"2024-07-18 03:22:55.361986 +0000 UTC","countOffers":927,"sellersCount":269,"productsCount":927,"type":"brand","favicon":null,"phoneNumber":null,"yandexVerification":null,"yandexMetrika":"91454819","googleVerification":"QOvgzq9JnSWoUXeRKs_almH7ktFKn1lxYn61ffisBg0","googleAnalytics":"G-274M2LXSP8","mailTop":"3269044","matomoId":null,"monogeo":"2","clid":null,"__typename":"Project"},"categories":[{"id":"01904a97-c2fb-7ccd-b071-6a02f3e187ea","name":"Пневмоинструменты","slug":"pnevmoinstrumenti","image":"/images/bc/32/c6/cb/c334cb8c.png","productsCount":123,"offersCount":123,"__typename":"Category"},{"id":"01904a97-c174-0b78-d5c1-fab396f007d6","name":"Сварочное оборудование","slug":"svarochnoe-oborudovanie","image":"/images/be/e5/81/2c/865ed23c.png","productsCount":111,"offersCount":111,"__typename":"Category"},{"id":"01904a97-d0ea-1d73-859f-daf4507caed4","name":"Оборудование для салонов красоты","slug":"oborudovanie-dlya-salonov-krasoti","image":"/images/ea/38/85/e5/9ed2989a.png","productsCount":95,"offersCount":95,"__typename":"Category"},{"id":"01904a97-cae8-804e-f77f-5f96c3c83fae","name":"Расходные материалы и оснастка","slug":"rashodnie-materiali-i-osnastka","image":"/images/bc/93/c3/6c/16a539d2.png","productsCount":67,"offersCount":67,"__typename":"Category"},{"id":"01904a97-c8ca-7ceb-fd81-17177720c35c","name":"Электроинструменты","slug":"elektroinstrumenti","image":"/images/e8/9e/97/61/9626ce26.png","productsCount":44,"offersCount":44,"__typename":"Category"},{"id":"01904a97-c355-2ac5-1cfc-46815f8a98e6","name":"Оснастка к садовой технике","slug":"osnastka-k-sadovoy-tehnike","image":"/images/ea/4b/59/db/478c8534.png","productsCount":41,"offersCount":41,"__typename":"Category"},{"id":"01904a97-da23-3e24-93cf-9a1dcb1a13b6","name":"Мойки ВД и аксессуары","slug":"moyki-vd-i-aksessuari","image":"/images/bc/c7/c6/cc/9438c137.png","productsCount":33,"offersCount":33,"__typename":"Category"},{"id":"01904a97-c1f3-9b4d-03ad-bfd35b04f2b4","name":"Насосы и комплектующие","slug":"nasosi-i-komplektuyushhie","image":"/images/b3/c3/99/2c/c932cccd.png","productsCount":32,"offersCount":32,"__typename":"Category"},{"id":"01904a97-cad6-85c2-59d2-822be173fd4f","name":"Ручной инструмент","slug":"ruchnoy-instrument","image":"/images/ea/4b/59/db/478c8534.png","productsCount":29,"offersCount":29,"__typename":"Category"},{"id":"01904a97-c8c9-d106-858b-e4a5ac233d72","name":"Уход за ногтями","slug":"uhod-za-nogtyami","image":"/images/c5/e8/6a/87/32962f1b.png","productsCount":23,"offersCount":23,"__typename":"Category"},{"id":"01904a97-cb0e-0617-7905-79af0ed089bd","name":"Приготовление блюд","slug":"prigotovlenie-blyud","image":"/images/b0/4b/4c/74/b4379b33.png","productsCount":16,"offersCount":16,"__typename":"Category"},{"id":"01904a97-c21f-3343-999c-e83758631c5b","name":"Измерительный инструмент","slug":"izmeritelniy-instrument","image":"/images/90/f8/35/9e/270cce73.png","productsCount":15,"offersCount":15,"__typename":"Category"},{"id":"01904a97-dd9e-f227-fe59-59bc6b43c0fb","name":"Электро- и бензопилы","slug":"elektro-i-benzopili","image":"/images/b3/f2/80/6f/4bb0a678.png","productsCount":14,"offersCount":14,"__typename":"Category"},{"id":"01904a97-cf07-c20d-3d41-2c29e3b03cac","name":"Насосы для подкачки шин","slug":"nasosi-dlya-podkachki-shin","image":"/images/b4/a7/c7/98/9b758a30.png","productsCount":11,"offersCount":11,"__typename":"Category"},{"id":"01904a97-c277-a048-b0ad-1078d2672956","name":"Кормление","slug":"kormlenie","image":"/images/b0/79/cf/c6/839292c7.png","productsCount":10,"offersCount":10,"__typename":"Category"},{"id":"01904a97-fe45-9b1a-3809-6e7b4cec7910","name":"Кухонные аксессуары","slug":"kuhonnie-aksessuari","image":"/images/b0/4d/cf/92/cf30cd61.png","productsCount":10,"offersCount":10,"__typename":"Category"}]},"host":"sergiev-posad.dgm-online.ru","cookies":{},"userAgent":"Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/537.36 (KHTML, like Gecko) Chrome/55.0.2883.87 Safari/537.36","pathname":"/","geo":{"name":"Сергиев Посад","address":["Капитолий","Новоугличское шоссе, 85","141301","(49654) 1-33-33"],"slug":"sergiev-posad","g":"в Сергиевом Посаде","r":"Сергиева Посада","coordinates":"38.124617 56.339821","__typename":"Geo"},"externalProductRelink":[],"__N_SSP":true},"page":"/","query":{},"buildId":"1Y7T-XcOMWjqKLrwqOiZl","isFallback":false,"gssp":true,"appGip":true,"scriptLoader":[]}</script><div id="modal-root"></div><script async="" src="https://aflt.market.yandex.ru/widget/script/api" type="text/javascript"></script><link href="https://revoluterra.ru/widget/index.css" rel="stylesheet"/><script async="" src="https://revoluterra.ru/widget/index.js" type="text/javascript"></script><script src="/scripts/crpr.js" defer=""></script><script src="https://revoluterra.ru/tag/tag.js"></script></body></html>
Copyright © 2002-9 Sam Ruby, Mark Pilgrim, Joseph Walton, and Phil Ringnalda